CMA1 (chymase 1)

Gene

• Entrez ID: 1215
• Gene name: Chymase 1
• Gene symbol: CMA1
• Synonyms: CYH, MCT1, chymase
• Chromosome: 14
• Chromosome location: 14q12
• Summary: This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants. [provided by RefSeq, Apr 2015]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002003	Process	Angiotensin maturation	TAS
GO:0004252	Function	Serine-type endopeptidase activity	IDA	1919436
GO:0004252	Function	Serine-type endopeptidase activity	NAS	8144971
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0008236	Function	Serine-type peptidase activity	EXP	2266130, 11502696
GO:0022617	Process	Extracellular matrix disassembly	IDA	27068509
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030141	Component	Secretory granule	IDA	29529050
GO:0030901	Process	Midbrain development	IEA
GO:0034769	Process	Basement membrane disassembly	IDA	27068509
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0042277	Function	Peptide binding	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0050727	Process	Regulation of inflammatory response	IDA	1919436
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	20551380
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0140447	Process	Cytokine precursor processing	IDA	1919436

Other IDs

• MIM: 118938
• HGNC: 2097
• e!Ensembl: ENSG00000092009

Protein

• UniProt ID: P23946
• Protein name: Chymase (EC 3.4.21.39) (Alpha-chymase) (Mast cell protease I)
• Protein function: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
• PDB: 1KLT, 1NN6, 1PJP, 1T31, 2HVX, 3N7O, 3S0N, 4AFQ, 4AFS, 4AFU, 4AFZ, 4AG1, 4AG2, 4K2Y, 4K5Z, 4K60, 4K69, 4KP0, 5YJM, 5YJP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	22 → 240	Trypsin	Domain

• Sequence:

  MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
  VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
  SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
  FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
  NQILQAN

• Sequence length: 247

Pathways

KEGG:

Renin-angiotensin system

Reactome:

Signaling by SCF-KIT
Activation of Matrix Metalloproteinases
Metabolism of Angiotensinogen to Angiotensins

Associated diseases

Disease name	Disease term	References
	Alveolitis, Fibrosing	15297733
	Hypertensive disease	14620933
	Left Ventricular Hypertrophy	14620933
	Pulmonary Fibrosis	15297733