GediPNet logo

CLCN1 (chloride voltage-gated channel 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1180
Gene nameGene Name - the full gene name approved by the HGNC.
Chloride voltage-gated channel 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CLCN1
SynonymsGene synonyms aliases
CLC1
ChromosomeChromosome number
7
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q34
SummarySummary of gene provided in NCBI Entrez Gene.
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encoded by this gene regulates the
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs55960271 C>A,T Pathogenic, likely-pathogenic Non coding transcript variant, stop gained, synonymous variant, coding sequence variant
rs80356684 A>T Pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356685 C>G Uncertain-significance, pathogenic, likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356686 G>A Pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356687 C>T Pathogenic-likely-pathogenic, pathogenic Missense variant, intron variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005247 Function Voltage-gated chloride channel activity IBA 21873635
GO:0005247 Function Voltage-gated chloride channel activity IMP 22521272, 26007199, 26502825
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P35523
Protein name Chloride channel protein 1 (ClC-1) (Chloride channel protein, skeletal muscle)
Protein function Voltage-gated chloride channel involved in skeletal muscle excitability. Generates most of the plasma membrane chloride conductance in skeletal muscle fibers, stabilizes the resting membrane potential and contributes to the repolarization phase
PDB 6COY , 6COZ , 6QV6 , 6QVB , 6QVC , 6QVD , 6QVU , 8WXI , 8WXJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00654 Voltage_CLC
170 572
Voltage gated chloride channel
Family
Sequence
MEQSRSQQRGGEQSWWGSDPQYQYMPFEHCTSYGLPSENGGLQHRLRKDAGPRHNVHPTQ
IYGHHKEQFSDREQDIGMPKKTGSSSTVDSKDEDHYSKCQDCIHRLGQVVRRKLGEDGIF
LVLLGLLMALVSWSMDYVSAKSLQAYKWSYAQMQPSLPLQFLVWVTFPLVLILFSALFCH
LISPQAVGSGIPEMKTILRGVVLKEYLTMKAFVAKVVALTAGLGSGIPVGKEGPFVHIAS
ICAAVLSKFMSVFCGVYEQPYYYSDILTVGCAVGVGCCFGTPLGGVLFSIEVTSTYFAVR
NYWRGFFAATFSAFVFRVLAVWNKDAVTITALFRTNFRMDFPFDLKELPAFAAIGICCGL
LGAVFVYLHRQVMLGVRKHKALSQFLAKHRLLYPGIVTFVIASFTFPPGMGQFMAGELMP
REAISTLFDNNTWVKHAGDPESLGQSAVWIHPRVNVVIIIFLFFVMKFWMSIVATTMPIP
CGGFMPVFVLGAAFGRLVGEIMAMLFPDGILFDDIIYKILPGGYAVIGAAALTGAVSHTV
STAVICFELTGQIAHILPMMVAVILANMVAQS
LQPSLYDSIIQVKKLPYLPDLGWNQLSK
YTIFVEDIMVRDVKFVSASYTYGELRTLLQTTTVKTLPLVDSKDSMILLGSVERSELQAL
LQRHLCPERRLRAAQEMARKLSELPYDGKARLAGEGLPGAPPGRPESFAFVDEDEDEDLS
GKSELPPSLALHPSTTAPLSPEEPNGPLPGHKQQPEAPEPAGQRPSIFQSLLHCLLGRAR
PTKKKTTQDSTDLVDNMSPEEIEAWEQEQLSQPVCFDSCCIDQSPFQLVEQTTLHKTHTL
FSLLGLHLAYVTSMGKLRGVLALEELQKAIEGHTKSGVQLRPPLASFRNTTSTRKSTGAP
PSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESP
GLEEELADILQGPSLRSTDEEDEDELIL
Sequence length 988
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Stimuli-sensing channels
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243
Congenital myotonia Becker Generalized Myotonia, Generalized Myotonia of Thomsen rs121912799, rs80356700, rs1563078827, rs121912801, rs80356694, rs80356696, rs80356690, rs121912805, rs80356702, rs121912807, rs140026363, rs55960271, rs80356699, rs1586496726, rs80356703, rs80356695, rs80356704, rs80356697, rs80356687, rs80356701, rs80356691, rs80356692, rs762754992, rs776073429, rs146457619, rs768119034, rs886041384, rs202217420, rs1057518917, rs759761559, rs756199349, rs1131691551, rs1229066957, rs774396430, rs767000881, rs756981034, rs763633152, rs769861892, rs375596425, rs1320040467, rs543120965, rs1554434400, rs759188441, rs1554434794, rs764100025, rs746125212, rs1027814542, rs529377088, rs752041565, rs770605959, rs770900468, rs1360333956, rs546411827, rs778647317, rs1803112361, rs1273524525, rs1460714146, rs1802715644 27614575, 23152584, 12390967, 19697366, 22521272, 1379744, 9566422, 10665666, 27118449, 18035046, 11840191, 27415035, 21221019, 26510092, 7951215, 28706458, 23739125, 18337730, 17932099, 26096614, 9736777, 11408615, 27296017, 18337100, 17097617, 25036107, 26007199, 15311340, 22649220, 27580824, 25438602, 22094069, 25749817, 23516313, 12661046, 23097607, 7874130, 10215406, 7951242, 24530047, 22921319, 22407275, 25065301, 22197187, 10644771, 21387378, 26502825, 26633545, 27142102, 17654559, 10051520, 9158157, 10430417, 17990293, 24349310, 8845168, 20399394, 10962018, 10737121, 12456818, 24304580, 11113225, 8112288, 28427807, 22346025, 22995991, 26021757, 24452722, 24037712, 7981750, 23225051, 8857733, 8533761, 7981681, 22641783, 23893571, 15162127, 7581380, 19949657, 23113340, 23810313, 10690989, 24515601, 23424641, 18220014, 20181190, 21204798, 23933576, 9122265, 8571958, 9040760, 27199537, 21045501, 27580824, 22649220, 17990293, 9158157, 23893571, 23516313, 27118449, 25065301, 17932099, 23113340, 10962018, 21204798, 11840191, 8845168, 25036107, 10644771, 23097607, 21387378, 23152584, 22197187, 12661046, 23225051, 8112288, 24349310, 12390967, 10665666, 25749817, 10690989, 25438602, 24515601, 24452722, 7981750, 22407275, 7581380, 9122265, 24037712, 21221019, 22094069, 24304580, 19949657, 27614575, 18035046, 7951215, 17097617, 28427807, 18337730, 19697366, 15162127, 15311340, 23424641, 21045501, 22921319, 26502825, 10430417, 27415035, 23739125, 1379744, 9566422, 27653901, 26096614, 27666773, 24530047, 17654559, 23810313, 28706458, 8857733, 9736777, 12456818, 27199537, 26633545, 18337100, 22521272, 20399394, 27142102, 27296017, 9040760, 26021757, 10737121, 23933576, 8533761, 26007199, 22346025, 11408615, 18220014, 20181190, 10051520, 7951242, 22995991, 7874130
Hyperkalemic periodic paralysis Hyperkalemic periodic paralysis rs80338957, rs80338962, rs121908544, rs121908545, rs80338958, rs121908546, rs121908556, rs80338792, rs121908547, rs121908548, rs121908549, rs121908551, rs121908552, rs80338784, rs80338788, rs80338785, rs121908555, rs121908557, rs121908559, rs80338956, rs80338955, rs80338789, rs80338959, rs80338960, rs527236148, rs527236150, rs864622785, rs886041805, rs750053946, rs1057521065, rs1064794243, rs1064795409, rs1555601448, rs780703403, rs1555600605, rs763893717, rs1567816549, rs771340029, rs1567817380, rs1567816461, rs1199222144, rs1235665641, rs774453167, rs1598405334, rs1567819905, rs1597985462, rs1908593639, rs1908916380, rs897448432, rs1909519361, rs1909650741 22649220
Myocardial infarction Myocardial Infarction rs12316150, rs41303970, rs909253, rs7291467, rs2234693
Unknown
Disease name Disease term dbSNP ID References
Dysphagia Deglutition Disorders
Hypoplasia of the maxilla Hypoplasia of the maxilla
Myotonia congenita Myotonia Congenita 24349310, 10430417, 18807109, 17932099, 11408615, 22649220, 21387378, 12390967, 20399394, 15786415, 11840191, 15241802, 8571958, 18337100, 23417379, 23516313, 8533761, 9736777, 7581380, 22094069, 9040658, 23152584, 23739125, 24920213, 12661046, 9158157, 11113225, 26036855
Myotonia levior Myotonia Levior 20399394

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412