ACSM1 (acyl-CoA synthetase medium chain family member 1)

Gene

• Entrez ID: 116285
• Gene name: Acyl-CoA synthetase medium chain family member 1
• Gene symbol: ACSM1
• Synonyms: BUCS1, MACS1
• Chromosome: 16
• Chromosome location: 16p12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016971	hsa-miR-335-5p	Microarray	18185580
MIRT2443089	hsa-miR-1252	CLIP-seq
MIRT2443090	hsa-miR-2681	CLIP-seq
MIRT2443091	hsa-miR-3673	CLIP-seq
MIRT2443092	hsa-miR-570	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0004321	Function	Fatty-acyl-CoA synthase activity	IBA	21873635
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	11470804
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005759	Component	Mitochondrial matrix	IBA	21873635
GO:0005759	Component	Mitochondrial matrix	IDA	11470804
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006633	Process	Fatty acid biosynthetic process	IBA	21873635
GO:0006637	Process	Acyl-CoA metabolic process	IBA	21873635
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0015645	Function	Fatty acid ligase activity	IBA	21873635
GO:0015980	Process	Energy derivation by oxidation of organic compounds	NAS	11470804
GO:0018858	Function	Benzoate-CoA ligase activity	IDA	10434065
GO:0018874	Process	Benzoate metabolic process	NAS	11470804
GO:0019395	Process	Fatty acid oxidation	NAS	11470804
GO:0019605	Process	Butyrate metabolic process	NAS	11470804
GO:0042632	Process	Cholesterol homeostasis	NAS	15361761
GO:0046872	Function	Metal ion binding	IEA
GO:0047760	Function	Butyrate-CoA ligase activity	IDA	10434065, 11470804
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0102391	Function	Decanoate-CoA ligase activity	IDA	10434065

Other IDs

• MIM: 614357
• HGNC: 18049
• e!Ensembl: ENSG00000166743

Protein

• UniProt ID: Q08AH1
• Protein name: Acyl-coenzyme A synthetase ACSM1, mitochondrial (EC 6.2.1.2) (Acyl-CoA synthetase medium-chain family member 1) (Benzoate--CoA ligase) (EC 6.2.1.25) (Butyrate--CoA ligase 1) (Butyryl-coenzyme A synthetase 1) (Lipoate-activating enzyme) (Middle-chain acyl-
• Protein function: Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism (PubMed:10434065). Capable of activating medium-chain fatty acids (e.g. butyric (C4) to decanoic (C10) acids), and certain carboxylate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00501	AMP-binding	62 → 475	AMP-binding enzyme	Family
  PF13193	AMP-binding_C	483 → 563	AMP-binding enzyme C-terminal domain	Domain

• Sequence:

  MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWA
  QKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQGDHLALMLPR
  VPEWWLVAVGCMRTGIIFIPATILLKAKDILYRLQLSKAKGIVTIDALASEVDSIASQCP
  SLKTKLLVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSH
  GLALQPSFPGSRKLRSLKTSDVSWCLSDSGWIVATIWTLVEPWTAGCTVFIHHLPQFDTK
  VIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
  LLLYENYGQSETGLICATYWGMKIKPGFMGKATPPYDVQVIDDKGSILPPNTEGNIGIRI
  KPVRPVSLFMCYEGDPEKTAKVECGDFYNTGDRGKMDEEGYICFLGRSDDIINASGYRIG
  PAEVESALVEHPAVAESAVVGSPDPIRGEVVKAFIVLTPQFLSHDKDQLTKELQQHVKSV
  TAPYKYPRKVEFVSELPKTITGKIERKELRKKETGQM

• Sequence length: 577

Pathways

KEGG:

Butanoate metabolism
Lipoic acid metabolism
Metabolic pathways

Reactome:

Conjugation of benzoate with glycine
Conjugation of phenylacetate with glutamine

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	17114358
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20185149, 25656805

Unknown
Disease name	Disease term	dbSNP ID	References
Lung neoplasms	Lung Neoplasms		17114358
Mental depression	Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	25656805