CKB (creatine kinase B)

Gene

• Entrez ID: 1152
• Gene name: Creatine kinase B
• Gene symbol: CKB
• Synonyms: B-CK, BCK, CKBB, CPK-B, HEL-211, HEL-S-29
• Chromosome: 14
• Chromosome location: 14q32.33
• Summary: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052190	hsa-let-7b-5p	CLASH	23622248
MIRT049124	hsa-miR-92a-3p	CLASH	23622248
MIRT044642	hsa-miR-320a	CLASH	23622248
MIRT043074	hsa-miR-324-5p	CLASH	23622248
MIRT042718	hsa-miR-346	CLASH	23622248
MIRT042674	hsa-miR-196b-5p	CLASH	23622248
MIRT037448	hsa-miR-744-5p	CLASH	23622248
MIRT037448	hsa-miR-744-5p	CLASH	23622248
MIRT036653	hsa-miR-935	CLASH	23622248
MIRT036653	hsa-miR-935	CLASH	23622248
MIRT052723	hsa-miR-1260b	CLASH	23622248
MIRT736752	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR,	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assay, qRT-PCR,	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assay, qRT-PCR,	25601461
MIRT735898	hsa-miR-483-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31792031
MIRT736752	hsa-miR-483-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	25601461
MIRT894208	hsa-miR-214	CLIP-seq
MIRT894209	hsa-miR-3619-5p	CLIP-seq
MIRT894210	hsa-miR-4291	CLIP-seq
MIRT894211	hsa-miR-4310	CLIP-seq
MIRT894212	hsa-miR-4645-5p	CLIP-seq
MIRT894213	hsa-miR-4662a-5p	CLIP-seq
MIRT894214	hsa-miR-4673	CLIP-seq
MIRT894215	hsa-miR-4711-5p	CLIP-seq
MIRT894216	hsa-miR-4742-5p	CLIP-seq
MIRT894217	hsa-miR-541	CLIP-seq
MIRT894218	hsa-miR-654-5p	CLIP-seq
MIRT894219	hsa-miR-761	CLIP-seq
MIRT894220	hsa-miR-922	CLIP-seq
MIRT1965138	hsa-miR-139-5p	CLIP-seq
MIRT894208	hsa-miR-214	CLIP-seq
MIRT1965139	hsa-miR-3120-3p	CLIP-seq
MIRT1965140	hsa-miR-342-5p	CLIP-seq
MIRT894209	hsa-miR-3619-5p	CLIP-seq
MIRT894210	hsa-miR-4291	CLIP-seq
MIRT894211	hsa-miR-4310	CLIP-seq
MIRT894213	hsa-miR-4662a-5p	CLIP-seq
MIRT1965141	hsa-miR-4664-5p	CLIP-seq
MIRT1965142	hsa-miR-4684-5p	CLIP-seq
MIRT894215	hsa-miR-4711-5p	CLIP-seq
MIRT894219	hsa-miR-761	CLIP-seq
MIRT894220	hsa-miR-922	CLIP-seq
MIRT1965140	hsa-miR-342-5p	CLIP-seq
MIRT1965141	hsa-miR-4664-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004111	Function	Creatine kinase activity	IBA	21873635
GO:0004111	Function	Creatine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 19264780, 25416956, 28514442, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006600	Process	Creatine metabolic process	TAS
GO:0016301	Function	Kinase activity	IBA	21873635
GO:0016310	Process	Phosphorylation	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030425	Component	Dendrite	IEA
GO:0030644	Process	Cellular chloride ion homeostasis	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078
GO:0043025	Component	Neuronal cell body	IEA
GO:0046314	Process	Phosphocreatine biosynthetic process	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 23533145

Other IDs

• MIM: 123280
• HGNC: 1991
• e!Ensembl: ENSG00000166165

Protein

• UniProt ID: P12277
• Protein name: Creatine kinase B-type (EC 2.7.3.2) (Brain creatine kinase) (B-CK) (Creatine kinase B chain) (Creatine phosphokinase B-type) (CPK-B)
• Protein function: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) (PubMed:8186255). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demand
• PDB: 3B6R, 3DRB, 3DRE, 6V9H, 7BF1, 7TUN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02807	ATP-gua_PtransN	24 → 94	ATP:guanido phosphotransferase, N-terminal domain	Domain
  PF00217	ATP-gua_Ptrans	153 → 367	ATP:guanido phosphotransferase, C-terminal catalytic domain	Domain

• Sequence:

  MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
  VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
  LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
  EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
  QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
  NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
  IEMEQRLEQGQAIDDLMPAQK

• Sequence length: 381

Pathways

KEGG:

Arginine and proline metabolism
Metabolic pathways

Reactome:

Creatine metabolism

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	15378696
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	15378696
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	15378696
Left ventricular hypertrophy	Left Ventricular Hypertrophy	rs397516037	11406506
Lung carcinoma	Small cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	2828370
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	12359538
Schizophrenia	Schizophrenia, Acute schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	22623148

Unknown
Disease name	Disease term	dbSNP ID	References
Coronary syndrome	Acute Coronary Syndrome	rs4986893	15966572
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		15378696