CIDEA (cell death inducing DFFA like effector a)

Gene

• Entrez ID: 1149
• Gene name: Cell death inducing DFFA like effector a
• Gene symbol: CIDEA
• Synonyms: CIDE-A
• Chromosome: 18
• Chromosome location: 18p11.21|18
• Summary: This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019409	hsa-miR-148b-3p	Microarray	17612493
MIRT2200858	hsa-miR-421	CLIP-seq
MIRT2200859	hsa-miR-4422	CLIP-seq
MIRT2200860	hsa-miR-4803	CLIP-seq
MIRT2200861	hsa-miR-543	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001659	Process	Temperature homeostasis	ISS
GO:0001818	Process	Negative regulation of cytokine production	IMP	15919794
GO:0005634	Component	Nucleus	ISS	17080483
GO:0005737	Component	Cytoplasm	ISS	17080483
GO:0005739	Component	Mitochondrion	ISS
GO:0005740	Component	Mitochondrial envelope	ISS
GO:0005811	Component	Lipid droplet	IDA	18509062
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0008219	Process	Cell death	ISS	17080483
GO:0010890	Process	Positive regulation of sequestering of triglyceride	ISS	18509062
GO:0019915	Process	Lipid storage	ISS
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS	17080483
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	15919794
GO:0034389	Process	Lipid droplet organization	TAS
GO:0035634	Process	Response to stilbenoid	IEA
GO:0042803	Function	Protein homodimerization activity	ISS	17080483
GO:0042981	Process	Regulation of apoptotic process	IBA	21873635
GO:0050995	Process	Negative regulation of lipid catabolic process	IMP	15919794
GO:0050995	Process	Negative regulation of lipid catabolic process	ISS
GO:0070417	Process	Cellular response to cold	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	12910269
GO:1900118	Process	Negative regulation of execution phase of apoptosis	ISS	17080483
GO:1902510	Process	Regulation of apoptotic DNA fragmentation	ISS	9564035

Other IDs

• MIM: 604440
• HGNC: 1976
• e!Ensembl: ENSG00000176194

Protein

• UniProt ID: O60543
• Protein name: Lipid transferase CIDEA (Cell death activator CIDE-A) (Cell death-inducing DFFA-like effector A)
• Protein function: Lipid transferase that promotes unilocular lipid droplet formation by mediating lipid droplet fusion (PubMed:19843876, PubMed:26118629). Lipid droplet fusion promotes their enlargement, restricting lipolysis and favoring lipid storage (PubMed:19
• PDB: 2EEL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02017	CIDE-N	34 → 109	CIDE-N domain	Domain

• Sequence:

  MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELIS
  KTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSP
  PKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYS
  AQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG

• Sequence length: 219

Pathways

KEGG:

AMPK signaling pathway

Reactome:

Lipid particle organization

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Myocardial infarction	Myocardial Failure	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	26670611
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	20975297

Unknown
Disease name	Disease term	dbSNP ID	References
Congestive heart failure	Congestive heart failure	rs2301610, rs3833910, rs12301951, rs201674674, rs186741807, rs150140412, rs786205727, rs757840030, rs552050895, rs759465783, rs201978086, rs572757800, rs1572143354, rs749160569	26670611
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided	rs121918074, rs142027794, rs148791216, rs72648927, rs71578935, rs142416150, rs199830512, rs755445214, rs150102469, rs779568205, rs907992794, rs1202130741	26670611
Liver neoplasms	Liver neoplasms		28108177, 25058030
Liver cancer	Malignant neoplasm of liver		28108177, 25058030