GediPNet logo

TIRAP (TIR domain containing adaptor protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114609
Gene nameGene Name - the full gene name approved by the HGNC.
TIR domain containing adaptor protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
TIRAP
SynonymsGene synonyms aliases
BACTS1, Mal, MyD88-2, wyatt
ChromosomeChromosome number
11
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.2
SummarySummary of gene provided in NCBI Entrez Gene.
The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004748 hsa-miR-145-5p Immunoprecipitaion, Western blot, Communoprecipitaion 19898489
MIRT674506 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT674505 hsa-miR-764 HITS-CLIP 23824327
MIRT674504 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT674503 hsa-miR-4635 HITS-CLIP 23824327
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002755 Process MyD88-dependent toll-like receptor signaling pathway TAS 19509286
GO:0005080 Function Protein kinase C binding IPI 17161867
GO:0005515 Function Protein binding IPI 11544529, 17258210, 17583698, 19509286, 19574958, 19948740, 21334391, 21829704, 21903422, 22155231, 24275656
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding ISS
GO:0005737 Component Cytoplasm IDA 19948740
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P58753
Protein name Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2)
Protein function Adapter involved in TLR2, TLR4 and RAGE signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response
PDB 2NDH , 2Y92 , 3UB2 , 3UB3 , 3UB4 , 4FZ5 , 4LQD , 5T7Q , 5UZB , 8JZM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13676 TIR_2
88 211
TIR domain
Domain
Sequence
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKE
AVMRYLQTLS
Sequence length 221
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Alcoholic liver disease
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Tuberculosis
Hepatitis B
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  ER-Phagosome pathway
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
MyD88 deficiency (TLR2/4)
IRAK4 deficiency (TLR2/4)
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 16284379
Unknown
Disease name Disease term dbSNP ID References
Prostatic neoplasms Prostatic Neoplasms 16284379

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412