Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
113523636 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Small integral membrane protein 40 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
SMIM40 |
SynonymsGene synonyms aliases
|
- |
ChromosomeChromosome number
|
6 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
6p21.32 |
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
GO ID |
Ontology |
Definition |
Evidence |
Reference |
GO:0016021 |
Component |
Integral component of membrane |
IEA |
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q5STR5 |
Protein name |
Small integral membrane protein 40 |
Family and domains |
|
Sequence |
MAEEGDVDEADVFLAFAQGPSPPRGPVRRALDKAFFIFLALFLTLLMLEAAYKLLWLLLW AKLGDWLLGTPQKEEELEL
|
|
Sequence length |
79 |
Interactions |
View interactions |
Associated diseases
|
|