GediPNet logo

SLC52A3 (solute carrier family 52 member 3)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
113278
Gene nameGene Name - the full gene name approved by the HGNC.
Solute carrier family 52 member 3
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SLC52A3
SynonymsGene synonyms aliases
BVVLS, BVVLS1, C20orf54, RFT2, RFVT3, bA371L19.1, hRFT2
ChromosomeChromosome number
20
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a riboflavin transporter protein that is strongly expressed in the intestine and likely plays a role in intestinal absorption of riboflavin. The protein is predicted to have eleven transmembrane domains and a cell surface localization si
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs3833341 ->GTCAATCAG,GTCAG Pathogenic, benign Intron variant
rs267606683 C>A,T Pathogenic Coding sequence variant, missense variant, stop gained
rs267606685 A>G Pathogenic Coding sequence variant, missense variant
rs267606688 G>A,T Pathogenic Coding sequence variant, missense variant
rs754753126 T>C,G Pathogenic Splice acceptor variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044271 hsa-miR-106b-5p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IDA 22273710
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9NQ40
Protein name Solute carrier family 52, riboflavin transporter, member 3 (Riboflavin transporter 2) (hRFT2)
Protein function Plasma membrane transporter mediating the uptake by cells of the water soluble vitamin B2/riboflavin that plays a key role in biochemical oxidation-reduction reactions of the carbohydrate, lipid, and amino acid metabolism (PubMed:20463145, PubMe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06237 DUF1011
297 395
Protein of unknown function (DUF1011)
Family
Sequence
MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTL
LHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDC
TSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPV
PTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFV
LQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
AFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSL
LFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGG
EVLIVASWVLFSGCLSYVKVMLGVV
LRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSADFCNLHCPA
Sequence length 469
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Vitamin digestion and absorption   Vitamin B2 (riboflavin) metabolism
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Brown-vialetto-van laere syndrome Brown-Vialetto-Van Laere Syndrome 1 rs794728004, rs267606683, rs267606685, rs267606688, rs398124641, rs397514538, rs148234606, rs397514657, rs398123067, rs398123068, rs375088539, rs374071862, rs754320812, rs368924997, rs754753126, rs778363575, rs797045190, rs879254305, rs782095095, rs1554854044, rs1555783467, rs782305211, rs1564657463, rs1568721373, rs1312209529, rs1586558204, rs1328651461 29053833, 22824638, 22633641, 20206331, 25462087, 27272163, 21110228, 27702554, 20920669, 28637675, 22718020, 26976849, 22273710
Diabetes insipidus Diabetes Insipidus rs781942628, rs104894747, rs104894748, rs104894749, rs104894750, rs28935496, rs2147483647, rs104894751, rs104894752, rs104894753, rs104894754, rs104894755, rs1569545523, rs104894756, rs104894757, rs104894758, rs104894759, rs104894760, rs121964892, rs104894328, rs104894329, rs1565636541, rs104894334, rs104894330, rs104894331, rs104894335, rs104894332, rs104894333, rs104894337, rs1565637179, rs1565637189, rs28931580, rs104894338, rs104894339, rs104894341, rs796052096, rs886040961, rs370879515, rs1057518723, rs1064797077, rs1131690792, rs1557100304, rs772201159, rs149659001, rs770810694, rs1557100594, rs1603282342, rs749468605
Dysautonomia Dysautonomia rs111033171, rs137853022, rs28939712, rs754348901, rs749052963, rs1057517169, rs1057516865, rs763445509, rs767527819, rs781333644, rs1239081703, rs1554696574, rs539544212, rs1201626345, rs774890086, rs1554703061, rs1554703613, rs1319053366, rs1554703851, rs868073099, rs926177767, rs376078668, rs1554695299, rs1554696648, rs1554696934, rs1554699327, rs1554691572, rs1554695846, rs1554697001, rs770668926, rs1554698037, rs759412460, rs1554702142, rs765572951, rs1554702880, rs1554703831, rs760774999, rs1554696650, rs757972943, rs1554703874, rs1554703907, rs571348995
Esophagus neoplasm Esophageal Neoplasms, Squamous cell carcinoma of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 20729853
Unknown
Disease name Disease term dbSNP ID References
Bulbar palsy Progressive bulbar palsy, Bulbar palsy
Cerebral cortical atrophy Cerebral cortical atrophy
Dysarthria Dysarthria
Dysmorphic features Dysmorphic features 26976849, 23107375, 22740598, 22824638, 25462087

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412