CHRM1 (cholinergic receptor muscarinic 1)

Gene

• Entrez ID: 1128
• Gene name: Cholinergic receptor muscarinic 1
• Gene symbol: CHRM1
• Synonyms: HM1, M1, M1R
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, pho

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007151	hsa-miR-107	Luciferase reporter assay	23423139
MIRT891610	hsa-miR-1197	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT891612	hsa-miR-3064-5p	CLIP-seq
MIRT891613	hsa-miR-3652	CLIP-seq
MIRT891614	hsa-miR-370	CLIP-seq
MIRT891615	hsa-miR-3925-5p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891617	hsa-miR-4430	CLIP-seq
MIRT891618	hsa-miR-4436a	CLIP-seq
MIRT891619	hsa-miR-4505	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT891621	hsa-miR-4640-5p	CLIP-seq
MIRT891622	hsa-miR-4650-5p	CLIP-seq
MIRT891623	hsa-miR-4726-5p	CLIP-seq
MIRT891624	hsa-miR-4755-3p	CLIP-seq
MIRT891625	hsa-miR-589	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT1964263	hsa-miR-149	CLIP-seq
MIRT1964264	hsa-miR-1915	CLIP-seq
MIRT891613	hsa-miR-3652	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891617	hsa-miR-4430	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT1964265	hsa-miR-628-5p	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT2386043	hsa-miR-1207-5p	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT2386044	hsa-miR-1909	CLIP-seq
MIRT2386045	hsa-miR-3188	CLIP-seq
MIRT2386046	hsa-miR-326	CLIP-seq
MIRT2386047	hsa-miR-330-5p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT2386048	hsa-miR-4667-5p	CLIP-seq
MIRT2386049	hsa-miR-4700-5p	CLIP-seq
MIRT2386050	hsa-miR-4763-3p	CLIP-seq
MIRT2386051	hsa-miR-486-3p	CLIP-seq
MIRT2386052	hsa-miR-637	CLIP-seq
MIRT2386053	hsa-miR-942	CLIP-seq
MIRT2503220	hsa-miR-1289	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT2503221	hsa-miR-4470	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004435	Function	Phosphatidylinositol phospholipase C activity	TAS	9614217
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	21056967
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	1411529
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	21873635
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA	21873635
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	9603968
GO:0007207	Process	Phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway	TAS	8139539
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	TAS	8139539
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007274	Process	Neuromuscular synaptic transmission	IEA
GO:0007399	Process	Nervous system development	TAS	2739737
GO:0016020	Component	Membrane	TAS	7925360
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IBA	21873635
GO:0030425	Component	Dendrite	IBA	21873635
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0040012	Process	Regulation of locomotion	IEA
GO:0043270	Process	Positive regulation of ion transport	IGI	14657398
GO:0043679	Component	Axon terminus	IEA
GO:0045202	Component	Synapse	IBA	21873635
GO:0046541	Process	Saliva secretion	IEA
GO:0050890	Process	Cognition	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060251	Process	Regulation of glial cell proliferation	TAS	2739737
GO:0090316	Process	Positive regulation of intracellular protein transport	IEA
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098981	Component	Cholinergic synapse	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:0099529	Function	Neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential	IEA

Other IDs

• MIM: 118510
• HGNC: 1950
• e!Ensembl: ENSG00000168539

Protein

• UniProt ID: P11229
• Protein name: Muscarinic acetylcholine receptor M1
• Protein function: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effec
• PDB: 5CXV, 6OIJ, 6WJC, 6ZFZ, 6ZG4, 6ZG9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	42 → 418	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
  NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
  FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
  QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
  SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
  VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
  KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
  CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC

• Sequence length: 460

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Alzheimer disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Muscarinic acetylcholine receptors
G alpha (q) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Epilepsy	Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs119454947, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs1805032, rs387906420, rs121917752, rs121918622, rs121434579, rs1581220270, rs281865564, rs387907313, rs397514564, rs397514670, rs768241563, rs587776973, rs587776974, rs587776975, rs879255234, rs587776976, rs587776977, rs121917993, rs398123588, rs13306758, rs587777363, rs587777364, rs587777458, rs587777459, rs541024038, rs797044545, rs730882240, rs786205703, rs794726859, rs796053126, rs796053035, rs796053216, rs796052839, rs869025201, rs797044999, rs797044998, rs797045045, rs794726762, rs869312971, rs869312972, rs879255652, rs886037938, rs886037958, rs886037959, rs886037960, rs886037961, rs886037962, rs886037965, rs886037966, rs886039245, rs886039246, rs886039251, rs886039252, rs772872014, rs886039253, rs886039256, rs757511744, rs886039261, rs886039263, rs578185749, rs886039266, rs886039268, rs886039269, rs886039273, rs368820286, rs1057518801, rs1057518688, rs1057519107, rs1057519273, rs752753379, rs767795673, rs1057519424, rs755946598, rs760609867, rs1057521066, rs1057524233, rs1060501488, rs1060501487, rs755127868, rs751533302, rs771373457, rs1475605360, rs1555401942, rs1553567864, rs200661329, rs766667249, rs1556607762, rs1555882921, rs1555882867, rs1555900914, rs1553546836, rs77216276, rs755595256, rs1554169267, rs747661902, rs2105890565, rs1021001959, rs1555441032, rs1555439541, rs1556526609, rs1315483224, rs759952667, rs1555885023, rs1553456695, rs1555942720, rs1569083500, rs1559127505, rs1206309859, rs1567139896, rs1567134495, rs1431914212, rs1569166925, rs1569255443, rs1568955379, rs1567152003, rs374158137, rs1567129567, rs1569523728, rs1568991466, rs1569186093, rs1569254004, rs1372605067, rs1569067939, rs1568963062, rs1563959514, rs1569012755, rs1559118914, rs1602338615, rs1596522356, rs1364913665, rs1596522300, rs1596526976, rs1229740428, rs1596385588, rs1596500172, rs1596505517, rs1601925213, rs1601970168, rs1602010382, rs1602903591, rs1603014297, rs1603014708, rs1601875057, rs1601970824, rs1601755632, rs1587393982, rs1592977444, rs1575562076, rs1570998206, rs1588057922, rs1596528731, rs1602349641, rs1587401875, rs2065899210, rs1596526915, rs2093486364, rs2056165149, rs2056100951, rs781482552, rs1899868619, rs1900088045, rs1898675878, rs1898686157, rs1898837245, rs1898844513, rs2082841677, rs2085727988, rs2092933941, rs2091657024, rs1899864955, rs1898844907, rs2083056830, rs2084070588, rs1899713412, rs2082695884, rs1977106116, rs1977105425, rs1443687532	18333967
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	22391213, 14504414, 23423139, 18317461
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	11392617, 12091480, 12713643, 10069499, 8028781, 11392617, 12713643, 12091480, 8028781, 10069499, 12091480, 8028781, 10069499, 12713643, 11392617, 12713643, 8028781, 12091480, 10069499, 11392617

Unknown
Disease name	Disease term	dbSNP ID	References
Cerebral ischemia	Brain Ischemia		18501976
Clonic seizures	Clonic Seizures		8028781, 11392617, 10069499, 12091480, 12713643
Hypotonic seizures	Epileptic drop attack		10069499, 11392617, 8028781, 12091480, 12713643
Jacksonian seizure	Jacksonian Seizure		8028781, 11392617, 12713643, 12091480, 10069499
Memory disorders	Memory Disorders		21682298
Age-related memory disorders	Age-Related Memory Disorders		21682298