Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
11270 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Nurim |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
NRM |
SynonymsGene synonyms aliases
|
NRM29 |
ChromosomeChromosome number
|
6 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
6p21.33 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternati |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q8IXM6 |
Protein name |
Nurim (Nuclear envelope membrane protein) (Nuclear rim protein) |
Family and domains |
|
Sequence |
MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIP KGPVLWEARAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE
|
|
Sequence length |
262 |
Interactions |
View interactions |
Associated diseases
|
|