GediPNet logo

MRAP2 (melanocortin 2 receptor accessory protein 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
112609
Gene nameGene Name - the full gene name approved by the HGNC.
Melanocortin 2 receptor accessory protein 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
MRAP2
SynonymsGene synonyms aliases
C6orf117, bA51G5.2
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q14.2
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that modulates melanocortin receptor signaling. The encoded protein has been shown to interact with all known melanocortin receptors and may regulate both receptor trafficking and activation in response to ligands. Mice lacking
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777046 G>A,T Risk-factor 5 prime UTR variant, missense variant, stop gained, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030877 hsa-miR-21-5p Microarray 18591254
MIRT1157505 hsa-miR-1302 CLIP-seq
MIRT1157506 hsa-miR-1343 CLIP-seq
MIRT1157507 hsa-miR-181a CLIP-seq
MIRT1157508 hsa-miR-181b CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19329486, 20371771, 28298427, 32296183, 32814053
GO:0005783 Component Endoplasmic reticulum IBA 21873635
GO:0005783 Component Endoplasmic reticulum IDA 19329486
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005886 Component Plasma membrane IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q96G30
Protein name Melanocortin-2 receptor accessory protein 2 (MC2R accessory protein 2)
Protein function Modulator of melanocortin receptor 4 (MC4R), a receptor involved in energy homeostasis. Plays a central role in the control of energy homeostasis and body weight regulation by increasing ligand-sensitivity of MC4R and MC4R-mediated generation of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15183 MRAP
13 99
Melanocortin-2 receptor accessory protein family
Family
Sequence
MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFM
FFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLE
PDKVFSRQGNEESRSLFHCYI
NEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGED
DLLISEPPIVLETKPLSQTSHKDLD
Sequence length 205
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Growth hormone synthesis, secretion and action  
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Obesity Obesity rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840 26795956
Unknown
Disease name Disease term dbSNP ID References
Prader-willi syndrome Prader-Willi Syndrome rs188762916, rs1555376130, rs35667483, rs74942536 26795956

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412