FSTL1 (follistatin like 1)

Gene

• Entrez ID: 11167
• Gene name: Follistatin like 1
• Gene symbol: FSTL1
• Synonyms: FRP, FSL1, MIR198, OCC-1, OCC1, tsc36
• Chromosome: 3
• Chromosome location: 3q13.33
• Summary: This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001789	hsa-miR-206	Reporter assay	17030984
MIRT020891	hsa-miR-155-5p	Proteomics	18668040
MIRT022846	hsa-miR-124-3p	Microarray	18668037
MIRT029771	hsa-miR-26b-5p	Microarray	19088304
MIRT040347	hsa-miR-615-3p	CLASH	23622248
MIRT045682	hsa-miR-149-5p	CLASH	23622248
MIRT051922	hsa-let-7b-5p	CLASH	23622248
MIRT054915	hsa-miR-198	Immunohistochemistry, qRT-PCR	23395958
MIRT054915	hsa-miR-198	Luciferase reporter assay, Next Generation Sequencing (NGS), Northern blot, qRT-PCR, Western blot	26386648
MIRT495912	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT714639	hsa-miR-152-5p	HITS-CLIP	19536157
MIRT714640	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT714641	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT714642	hsa-miR-653-3p	HITS-CLIP	19536157
MIRT714643	hsa-miR-4420	HITS-CLIP	19536157
MIRT714644	hsa-miR-181b-3p	HITS-CLIP	19536157
MIRT714645	hsa-miR-181b-2-3p	HITS-CLIP	19536157
MIRT714646	hsa-miR-3689f	HITS-CLIP	19536157
MIRT714647	hsa-miR-3689e	HITS-CLIP	19536157
MIRT714648	hsa-miR-3689b-5p	HITS-CLIP	19536157
MIRT714649	hsa-miR-3689a-5p	HITS-CLIP	19536157
MIRT714650	hsa-miR-4679	HITS-CLIP	19536157
MIRT714651	hsa-miR-4677-3p	HITS-CLIP	19536157
MIRT714652	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714653	hsa-miR-1208	HITS-CLIP	19536157
MIRT714654	hsa-miR-6760-3p	HITS-CLIP	19536157
MIRT732311	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27498552
MIRT732619	hsa-miR-29a-3p	Next Generation Sequencing (NGS), qRT-PCR, Western blot	26199111
MIRT741737	hsa-miR-3620-3p	PAR-CLIP	26701625
MIRT742930	hsa-miR-3918	PAR-CLIP	26701625
MIRT745845	hsa-miR-4524a-3p	PAR-CLIP	26701625
MIRT745881	hsa-miR-4524b-3p	PAR-CLIP	26701625
MIRT746790	hsa-miR-4667-3p	PAR-CLIP	26701625
MIRT754567	hsa-miR-6750-3p	PAR-CLIP	26701625
MIRT755771	hsa-miR-6784-3p	PAR-CLIP	26701625
MIRT757881	hsa-miR-6862-3p	PAR-CLIP	26701625
MIRT757919	hsa-miR-6865-3p	PAR-CLIP	26701625
MIRT758798	hsa-miR-6895-5p	PAR-CLIP	26701625
MIRT759986	hsa-miR-7975	PAR-CLIP	26701625

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	19060904, 20860622, 22265692, 25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0008201	Function	Heparin binding	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030509	Process	BMP signaling pathway	TAS
GO:0030510	Process	Regulation of BMP signaling pathway	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043542	Process	Endothelial cell migration	ISS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045446	Process	Endothelial cell differentiation	ISS
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 605547
• HGNC: 3972
• e!Ensembl: ENSG00000163430

Protein

• UniProt ID: Q12841
• Protein name: Follistatin-related protein 1 (Follistatin-like protein 1)
• Protein function: Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation (PubMed:29212066, PubMed:22265692). Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter (By similarity). Promotes endothelial cell survival, migration and differentiation into network structures in an AKT-dependent manner. Also promotes survival of cardiac myocytes (By similarity). Initiates various signaling cascades by activating different receptors on the cell surface such as DIP2A, TLR4 or BMP receptors (PubMed:20054002, PubMed:22265692).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09289	FOLN	31 → 52	Follistatin/Osteonectin-like EGF domain	Domain
  PF07648	Kazal_2	53 → 98	Kazal-type serine protease inhibitor domain	Domain

• Sequence:

  MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
  HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE
  LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
  ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
  ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
  KRVSTKEI

• Sequence length: 308

Pathways

Reactome:

Signaling by BMP
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs-1, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	17849003

Unknown
Disease name	Disease term	dbSNP ID	References
Aortic valve insufficiency	Aortic Valve Insufficiency		21216836
Kidney failure	Kidney Failure, Acute		20861081
Acute kidney insufficiency	Acute Kidney Insufficiency		20861081
Scleroderma	Systemic Scleroderma		27482699