GediPNet logo

FSTL1 (follistatin like 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11167
Gene nameGene Name - the full gene name approved by the HGNC.
Follistatin like 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
FSTL1
SynonymsGene synonyms aliases
FRP, FSL1, MIR198, OCC-1, OCC1, tsc36
ChromosomeChromosome number
3
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheu
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020891 hsa-miR-155-5p Proteomics 18668040
MIRT001789 hsa-miR-206 Reporter assay 17030984
MIRT022846 hsa-miR-124-3p Microarray 18668037
MIRT029771 hsa-miR-26b-5p Microarray 19088304
MIRT051922 hsa-let-7b-5p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 19060904, 20860622, 22265692, 25416956, 32296183, 32814053
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space HDA 16502470
GO:0005788 Component Endoplasmic reticulum lumen TAS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q12841
Protein name Follistatin-related protein 1 (Follistatin-like protein 1)
Protein function Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation (PubMed:22265692, PubMed:29212066). Plays a role in the development of the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09289 FOLN
31 52
Follistatin/Osteonectin-like EGF domain
Domain
PF07648 Kazal_2
53 98
Kazal-type serine protease inhibitor domain
Domain
Sequence
MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHC
KEKKSVSPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
KRVSTKEI
Sequence length 308
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Signaling by BMP
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 17849003
Unknown
Disease name Disease term dbSNP ID References
Aortic valve insufficiency Aortic Valve Insufficiency 21216836
Kidney failure Kidney Failure, Acute 20861081
Acute kidney insufficiency Acute Kidney Insufficiency 20861081
Scleroderma Systemic Scleroderma 27482699

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412