CD160 (CD160 molecule)

Gene

• Entrez ID: 11126
• Gene name: CD160 molecule
• Gene symbol: CD160
• Synonyms: BY55, NK1, NK28
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018975	hsa-miR-335-5p	Microarray	18185580
MIRT732966	hsa-miR-1236-3p	qRT-PCR	33788641
MIRT873735	hsa-miR-361-3p	CLIP-seq
MIRT873736	hsa-miR-3679-3p	CLIP-seq
MIRT873737	hsa-miR-3938	CLIP-seq
MIRT873738	hsa-miR-4282	CLIP-seq
MIRT2196124	hsa-miR-561	CLIP-seq
MIRT2499224	hsa-miR-3945	CLIP-seq
MIRT2499225	hsa-miR-4253	CLIP-seq
MIRT2499226	hsa-miR-4311	CLIP-seq
MIRT2499227	hsa-miR-4729	CLIP-seq
MIRT2499228	hsa-miR-539	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002385	Process	Mucosal immune response	IEA
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IDA	17307798
GO:0002857	Process	Positive regulation of natural killer cell mediated immune response to tumor cell	IEA
GO:0005102	Function	Signaling receptor binding	IDA	9973372
GO:0005515	Function	Protein binding	IPI	11978774, 16809620, 18193050, 25416956, 27152329, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	11978774, 18193050
GO:0005886	Component	Plasma membrane	TAS
GO:0014065	Process	Phosphatidylinositol 3-kinase signaling	IDA	17307798
GO:0016525	Process	Negative regulation of angiogenesis	IDA	16809620
GO:0019900	Function	Kinase binding	IPI	11978774
GO:0023024	Function	MHC class I protein complex binding	IEA
GO:0031295	Process	T cell costimulation	IDA	9973372, 11978774
GO:0032393	Function	MHC class I receptor activity	IDA	15494480
GO:0032394	Function	MHC class Ib receptor activity	IDA	16809620
GO:0032397	Function	Activating MHC class I receptor activity	IDA	9973372, 11978774, 12486241
GO:0032729	Process	Positive regulation of interferon-gamma production	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	12486241, 17307798
GO:0046658	Component	Anchored component of plasma membrane	IBA	21873635
GO:0046658	Component	Anchored component of plasma membrane	IDA	9973372
GO:0050776	Process	Regulation of immune response	TAS
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	18193050
GO:1900280	Process	Negative regulation of CD4-positive, alpha-beta T cell costimulation	IDA	18193050
GO:1905675	Process	Negative regulation of adaptive immune memory response	IDA	18193050
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	16809620

Other IDs

• MIM: 604463
• HGNC: 17013
• e!Ensembl: ENSG00000117281

Protein

• UniProt ID: O95971
• Protein name: CD160 antigen (Natural killer cell receptor BY55) (CD antigen CD160) [Cleaved into: CD160 antigen, soluble form]
• Protein function: [CD160 antigen]: Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pat
• PDB: 6NG3, 6NG9, 6NGG, 7MSG
• Sequence:

  MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFL
  CKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSG
  IRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQA
  L

• Sequence length: 181

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs10520699, rs11852999, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	29059683

Unknown
Disease name	Disease term	dbSNP ID	References
Gout	Gout		23263486
Gouty arthritis	Arthritis, Gouty		23263486