KATNA1 (katanin catalytic subunit A1)

Gene

• Entrez ID: 11104
• Gene name: Katanin catalytic subunit A1
• Gene symbol: KATNA1
• Synonyms: -
• Chromosome: 6
• Chromosome location: 6q25.1
• Summary: Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002617	hsa-miR-124-3p	Microarray	18668037
MIRT002617	hsa-miR-124-3p	Microarray	15685193

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IDA	10751153, 19261606
GO:0005515	Function	Protein binding	IPI	19261606, 24486153, 26496610, 26929214, 28514442
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	19261606, 26929214
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IDA	19261606
GO:0005874	Component	Microtubule	IEA
GO:0007049	Process	Cell cycle	IEA
GO:0008017	Function	Microtubule binding	IDA	10751153
GO:0008568	Function	Microtubule-severing ATPase activity	IBA	21873635
GO:0008568	Function	Microtubule-severing ATPase activity	IDA	10751153
GO:0015630	Component	Microtubule cytoskeleton	IBA	21873635
GO:0016853	Function	Isomerase activity	IEA
GO:0016887	Function	ATPase activity	IBA	21873635
GO:0030496	Component	Midbody	IDA	19261606
GO:0031122	Process	Cytoplasmic microtubule organization	IBA	21873635
GO:0046982	Function	Protein heterodimerization activity	IPI	10751153
GO:0051013	Process	Microtubule severing	IBA	21873635
GO:0051301	Process	Cell division	IEA
GO:0097431	Component	Mitotic spindle pole	IDA	26929214

Other IDs

• MIM: 606696
• HGNC: 6216
• e!Ensembl: ENSG00000186625

Protein

• UniProt ID: O75449
• Protein name: Katanin p60 ATPase-containing subunit A1 (Katanin p60 subunit A1) (EC 5.6.1.1) (p60 katanin)
• Protein function: Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. M
• PDB: 5ZQL, 5ZQM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00004	AAA	245 → 381	ATPase family associated with various cellular activities (AAA)	Domain
  PF17862	AAA_lid_3	403 → 464	AAA+ lid domain	Domain
  PF09336	Vps4_C	439 → 489	Vps4 C terminal oligomerisation domain	Domain

• Sequence:

  MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
  VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
  SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
  KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
  PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
  SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
  FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
  ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
  YEKWIFEFGSC

• Sequence length: 491

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lung carcinoma	Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	27393504