ESM1 (endothelial cell specific molecule 1)

Gene

• Entrez ID: 11082
• Gene name: Endothelial cell specific molecule 1
• Gene symbol: ESM1
• Synonyms: endocan
• Chromosome: 5
• Chromosome location: 5q11.2
• Summary: This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disor

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT717078	hsa-miR-4640-3p	HITS-CLIP	19536157
MIRT717077	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT717076	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT717075	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT717074	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT717073	hsa-miR-1260a	HITS-CLIP	19536157
MIRT717072	hsa-miR-1260b	HITS-CLIP	19536157
MIRT717078	hsa-miR-4640-3p	HITS-CLIP	19536157
MIRT717077	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT717076	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT717075	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT717074	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT717073	hsa-miR-1260a	HITS-CLIP	19536157
MIRT717072	hsa-miR-1260b	HITS-CLIP	19536157
MIRT970230	hsa-miR-1260	CLIP-seq
MIRT970231	hsa-miR-181a	CLIP-seq
MIRT970232	hsa-miR-181b	CLIP-seq
MIRT970233	hsa-miR-181c	CLIP-seq
MIRT970234	hsa-miR-181d	CLIP-seq
MIRT970235	hsa-miR-188-3p	CLIP-seq
MIRT970236	hsa-miR-3156-3p	CLIP-seq
MIRT970237	hsa-miR-4262	CLIP-seq
MIRT970238	hsa-miR-4297	CLIP-seq
MIRT970239	hsa-miR-513b	CLIP-seq
MIRT1987537	hsa-miR-154	CLIP-seq
MIRT1987538	hsa-miR-3163	CLIP-seq
MIRT1987539	hsa-miR-4477a	CLIP-seq
MIRT1987540	hsa-miR-4795-3p	CLIP-seq
MIRT1987541	hsa-miR-556-3p	CLIP-seq
MIRT2221973	hsa-miR-3976	CLIP-seq
MIRT2221974	hsa-miR-489	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA	21873635
GO:0001525	Process	Angiogenesis	IEP	11866539
GO:0002040	Process	Sprouting angiogenesis	IMP	20616313
GO:0005171	Function	Hepatocyte growth factor receptor binding	IBA	21873635
GO:0005171	Function	Hepatocyte growth factor receptor binding	IPI	11590178
GO:0005178	Function	Integrin binding	IBA	21873635
GO:0005178	Function	Integrin binding	IPI	11544294
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11590178
GO:1902204	Process	Positive regulation of hepatocyte growth factor receptor signaling pathway	IBA	21873635
GO:1902204	Process	Positive regulation of hepatocyte growth factor receptor signaling pathway	IDA	11590178

Other IDs

• MIM: 601521
• HGNC: 3466
• e!Ensembl: ENSG00000164283

Protein

• UniProt ID: Q9NQ30
• Protein name: Endothelial cell-specific molecule 1 (ESM-1)
• Protein function: Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	28 → 83	Insulin-like growth factor binding protein	Domain

• Sequence:

  MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG
  RGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSG
  ICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKW
  LNPR

• Sequence length: 184

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lung carcinoma	Squamous cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	29924316

Unknown
Disease name	Disease term	dbSNP ID	References
Liver neoplasms	Liver neoplasms		28108177
Liver cancer	Malignant neoplasm of liver		28108177
Liver carcinoma	Liver carcinoma		28284560