GTF2A1L (general transcription factor IIA subunit 1 like)

Gene

• Entrez ID: 11036
• Gene name: General transcription factor IIA subunit 1 like
• Gene symbol: GTF2A1L
• Synonyms: ALF
• Chromosome: 2
• Chromosome location: 2p16.3
• Summary: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of transcription factor IIA (TFIIA) on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1549413	hsa-miR-4719	CLIP-seq
MIRT1549414	hsa-miR-513b	CLIP-seq
MIRT1549413	hsa-miR-4719	CLIP-seq
MIRT1549414	hsa-miR-513b	CLIP-seq
MIRT1549413	hsa-miR-4719	CLIP-seq
MIRT1549414	hsa-miR-513b	CLIP-seq
MIRT1549413	hsa-miR-4719	CLIP-seq
MIRT1549414	hsa-miR-513b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	TAS	10364255
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005672	Component	Transcription factor TFIIA complex	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IBA	21873635
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0050890	Process	Cognition	IMP	23227193

Other IDs

• MIM: 605358
• HGNC: 30727
• e!Ensembl: ENSG00000242441

Protein

• UniProt ID: Q9UNN4
• Protein name: TFIIA-alpha and beta-like factor (General transcription factor II A, 1-like factor)
• Protein function: May function as a testis specific transcription factor. Binds DNA in conjunction with GTF2A2 and TBP (the TATA-binding protein) and together with GTF2A2, allows mRNA transcription.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03153	TFIIA	10 → 478	Transcription factor IIA, alpha/beta subunit	Family

• Sequence:

  MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
  IQSPLFTLQLPHSLHQTLQSSTASLVIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVP
  AGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHPIQQVFQQLGQPSVIQTSVPQLNPWSL
  QATTEKSQRIETVLQQPAILPSGPVDRKHLENATSDILVSPGNEHKIVPEALLCHQESSH
  YISLPGVVFSPQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILK
  NRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQVDGSGDTSSNEE
  IGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
  DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW

• Sequence length: 478

Pathways

KEGG:

Basal transcription factors
Viral carcinogenesis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Leydig cell agenesis	Leydig cell agenesis	rs121912537, rs121912520, rs121912523, rs121912524, rs121912525, rs121912529, rs2104352652, rs71245621, rs121912536, rs121912538, rs121912539, rs144859947, rs773279269, rs1553387851, rs140568136, rs1572874955
Pseudohermaphroditism	Pseudohermaphroditism	rs119481075, rs119481076, rs119481077, rs201115371, rs144809928, rs750481017, rs372027264, rs773720185, rs1554694264, rs1554694678, rs747724352, rs767765046, rs149607031, rs1554705693
Somatic leydig cell adenoma with male-limited precocious puberty	Leydig Cell Adenoma, Somatic, with Male-Limited Precocious Puberty	rs121912532

Unknown
Disease name	Disease term	dbSNP ID	References
Luteinizing hormone resistance, female	Luteinizing Hormone Resistance, Female
Physiologic amenorrhea	Primary physiologic amenorrhea
Testotoxicosis	Familial Testotoxicosis