GediPNet logo

PGRMC1 (progesterone receptor membrane component 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10857
Gene nameGene Name - the full gene name approved by the HGNC.
Progesterone receptor membrane component 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
PGRMC1
SynonymsGene synonyms aliases
Dap1, HPR6.6, IZA, MPR
ChromosomeChromosome number
X
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq24
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010]
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001609 hsa-let-7b-5p pSILAC 18668040
MIRT027601 hsa-miR-98-5p Microarray 19088304
MIRT001609 hsa-let-7b-5p Proteomics;Other 18668040
MIRT050203 hsa-miR-25-3p CLASH 23622248
MIRT044164 hsa-miR-130b-3p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding TAS 26871627
GO:0005496 Function Steroid binding IEA
GO:0005515 Function Protein binding IPI 21081644, 26988023, 27599036, 32296183
GO:0005741 Component Mitochondrial outer membrane ISS
GO:0005783 Component Endoplasmic reticulum TAS 25390692
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O00264
Protein name Membrane-associated progesterone receptor component 1 (mPR) (Dap1) (IZA)
Protein function Component of a progesterone-binding protein complex (PubMed:28396637). Binds progesterone (PubMed:25675345). Has many reported cellular functions (heme homeostasis, interaction with CYPs). Required for the maintenance of uterine histoarchitectur
PDB 4X8Y
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00173 Cyt-b5
74 171
Cytochrome b5-like Heme/Steroid binding domain
Domain
Sequence
MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDD
EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLL
KEGEEPTVY
SDEEEPKDESARKND
Sequence length 195
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Neuroactive ligand-receptor interaction   Neutrophil degranulation
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316 25390692
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17199135
Unknown
Disease name Disease term dbSNP ID References
Premature menopause Premature Menopause 25246111
Ovarian failure NON RARE IN EUROPE: Primary ovarian failure
Prostatic neoplasms Prostatic Neoplasms 17199135
Senile dementia Presenile dementia, Acute Confusional Senile Dementia 25390692

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412