NRG3 (neuregulin 3)

Gene

• Entrez ID: 10718
• Gene name: Neuregulin 3
• Gene symbol: NRG3
• Synonyms: HRG3, pro-NRG3
• Chromosome: 10
• Chromosome location: 10q23.1
• Summary: This gene is a member of the neuregulin gene family. This gene family encodes ligands for the transmembrane tyrosine kinase receptors ERBB3 and ERBB4 - members of the epidermal growth factor receptor family. Ligand binding activates intracellular signalin

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs138878772	G>A	Benign, likely-pathogenic	Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1193928	hsa-miR-1267	CLIP-seq
MIRT1193929	hsa-miR-1470	CLIP-seq
MIRT1193930	hsa-miR-188-5p	CLIP-seq
MIRT1193931	hsa-miR-3074-5p	CLIP-seq
MIRT1193932	hsa-miR-3124-3p	CLIP-seq
MIRT1193933	hsa-miR-3140-5p	CLIP-seq
MIRT1193934	hsa-miR-3183	CLIP-seq
MIRT1193935	hsa-miR-330-3p	CLIP-seq
MIRT1193936	hsa-miR-3591-5p	CLIP-seq
MIRT1193937	hsa-miR-3606	CLIP-seq
MIRT1193938	hsa-miR-3653	CLIP-seq
MIRT1193939	hsa-miR-3658	CLIP-seq
MIRT1193940	hsa-miR-4422	CLIP-seq
MIRT1193941	hsa-miR-4462	CLIP-seq
MIRT1193942	hsa-miR-4511	CLIP-seq
MIRT1193943	hsa-miR-4539	CLIP-seq
MIRT1193944	hsa-miR-4637	CLIP-seq
MIRT1193945	hsa-miR-4667-3p	CLIP-seq
MIRT1193946	hsa-miR-4723-3p	CLIP-seq
MIRT1193947	hsa-miR-4724-5p	CLIP-seq
MIRT1193948	hsa-miR-4753-3p	CLIP-seq
MIRT1193949	hsa-miR-548b-3p	CLIP-seq
MIRT1193950	hsa-miR-921	CLIP-seq
MIRT1193928	hsa-miR-1267	CLIP-seq
MIRT1193931	hsa-miR-3074-5p	CLIP-seq
MIRT2056235	hsa-miR-3121-3p	CLIP-seq
MIRT1193932	hsa-miR-3124-3p	CLIP-seq
MIRT1193934	hsa-miR-3183	CLIP-seq
MIRT1193935	hsa-miR-330-3p	CLIP-seq
MIRT2056236	hsa-miR-3671	CLIP-seq
MIRT1193940	hsa-miR-4422	CLIP-seq
MIRT2056237	hsa-miR-4427	CLIP-seq
MIRT2056238	hsa-miR-4643	CLIP-seq
MIRT1193946	hsa-miR-4723-3p	CLIP-seq
MIRT1193948	hsa-miR-4753-3p	CLIP-seq
MIRT1193928	hsa-miR-1267	CLIP-seq
MIRT1193931	hsa-miR-3074-5p	CLIP-seq
MIRT1193932	hsa-miR-3124-3p	CLIP-seq
MIRT1193934	hsa-miR-3183	CLIP-seq
MIRT1193935	hsa-miR-330-3p	CLIP-seq
MIRT1193940	hsa-miR-4422	CLIP-seq
MIRT1193946	hsa-miR-4723-3p	CLIP-seq
MIRT1193948	hsa-miR-4753-3p	CLIP-seq
MIRT2391744	hsa-miR-4433	CLIP-seq
MIRT2391745	hsa-miR-4459	CLIP-seq
MIRT2391746	hsa-miR-4762-5p	CLIP-seq
MIRT2391747	hsa-miR-4768-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	9275162
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005576	Component	Extracellular region	NAS	9275162
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	NAS	9275162
GO:0007171	Process	Activation of transmembrane receptor protein tyrosine kinase activity	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0008083	Function	Growth factor activity	NAS	9275162
GO:0021842	Process	Chemorepulsion involved in interneuron migration from the subpallium to the cortex	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	NAS	9275162
GO:0030971	Function	Receptor tyrosine kinase binding	NAS	9275162
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0045499	Function	Chemorepellent activity	IBA	21873635
GO:0048513	Process	Animal organ development	IBA	21873635
GO:0050804	Process	Modulation of chemical synaptic transmission	IMP	29114105
GO:0060596	Process	Mammary placode formation	IEA
GO:0098978	Component	Glutamatergic synapse	IMP	29114105
GO:2001223	Process	Negative regulation of neuron migration	IEA

Other IDs

• MIM: 605533
• HGNC: 7999
• e!Ensembl: ENSG00000185737

Protein

• UniProt ID: P56975
• Protein name: Pro-neuregulin-3, membrane-bound isoform (Pro-NRG3) [Cleaved into: Neuregulin-3 (NRG-3)]
• Protein function: Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligode
• Sequence:

  MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
  NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
  FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
  STTARNTAAPATVPSTTAPFFSSSTLGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTP
  SWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
  DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQ
  VLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV
  KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPG
  QRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPI
  QLWCVERPLDLKYSSSGLKTQRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPI
  IPSVGLEETCLQMPGISEVKSIKWCKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQE
  QIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK
  

• Sequence length: 720

Pathways

KEGG:

ErbB signaling pathway
Amyotrophic lateral sclerosis

Reactome:

Signaling by ERBB2
Signaling by ERBB4
SHC1 events in ERBB2 signaling
PI3K events in ERBB4 signaling
SHC1 events in ERBB4 signaling
PIP3 activates AKT signaling
GRB2 events in ERBB2 signaling
PI3K events in ERBB2 signaling
Constitutive Signaling by Aberrant PI3K in Cancer
RAF/MAP kinase cascade
ERBB2 Regulates Cell Motility
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
ERBB2 Activates PTK6 Signaling
Downregulation of ERBB2 signaling
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 TMD/JMD mutants

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20713722

Unknown
Disease name	Disease term	dbSNP ID	References
Achoo syndrome	Autosomal dominant compelling helio ophthalmic outburst syndrome		27182965
Bipolar disorder	Bipolar Disorder		19765633, 22831755