GediPNet logo

B3GNT2 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10678
Gene nameGene Name - the full gene name approved by the HGNC.
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
B3GNT2
SynonymsGene synonyms aliases
3-Gn-T1, 3-Gn-T2, B3GN-T2, B3GNT, B3GNT-2, B3GNT1, BETA3GNT, BGNT2, BGnT-2, beta-1, beta3Gn-T1, beta3Gn-T2
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p15
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022296 hsa-miR-124-3p Microarray 18668037
MIRT023499 hsa-miR-1-3p Microarray 18668037
MIRT303046 hsa-miR-10a-3p PAR-CLIP 20371350
MIRT089117 hsa-miR-5583-3p PAR-CLIP 20371350
MIRT089105 hsa-miR-15a-5p PAR-CLIP 20371350
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 18826941
GO:0005794 Component Golgi apparatus IBA 21873635
GO:0006486 Process Protein glycosylation IBA 21873635
GO:0007411 Process Axon guidance IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9NY97
Protein name N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 (EC 2.4.1.149) (Beta-1,3-N-acetylglucosaminyltransferase 1) (BGnT-1) (Beta-1,3-Gn-T1) (Beta3Gn-T1) (Beta-1,3-galactosyltransferase 7) (Beta-1,3-GalTase 7) (Beta3Gal-T7) (Beta3GalT7) (b3Gal-T
Protein function Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Catalyzes the initiation and elongation of poly-N-acetyllactosamine chains. Shows a marked preference for Gal(beta1-4)Glc(NAc)-based acceptors (PubMe
PDB 6WMM , 6WMN , 6WMO , 7JHK , 7JHL , 7JHM , 7JHN , 7JHO , 8SZ3 , 8TIC , 8TJC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01762 Galactosyl_T
156 351
Galactosyltransferase
Family
Sequence
MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWN
REQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFL
LYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVF
LLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEF
VFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLY
PPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHK
GFRTFDIEE
KNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC
Sequence length 397
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
  Keratan sulfate biosynthesis
O-linked glycosylation of mucins
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Congenital muscular dystrophy-dystroglycanopathy with brain and eye anomalies MUSCULAR DYSTROPHY-DYSTROGLYCANOPATHY (CONGENITAL WITH BRAIN AND EYE ANOMALIES), TYPE A, 13 rs119463990, rs587777813, rs398123555, rs119463996, rs587777748, rs119463991, rs119463992, rs119464997, rs267606814, rs119463989, rs533916138, rs587777815, rs200198778, rs267606969, rs267606963, rs267606964, rs267606965, rs267606966, rs267606970, rs587777816, rs918556979, rs28941782, rs119462981, rs587777817, rs587777818, rs119462982, rs587777819, rs587777820, rs398124245, rs587777821, rs193919335, rs386834017, rs28942068, rs193919336, rs587777822, rs267606961, rs386834035, rs104894679, rs104894680, rs28937902, rs28937903, rs28937904, rs104894691, rs104894692, rs104894684, rs267607209, rs267607210, rs387907299, rs752069645, rs397514543, rs150736997, rs397514545, rs397514546, rs367543076, rs367543070, rs367543073, rs397514695, rs397514696, rs397509385, rs386834012, rs386834025, rs386834032, rs386834038, rs397509422, rs397509423, rs202160208, rs398123557, rs200056620, rs398124247, rs398124395, rs587777223, rs367543069, rs367543075, rs587777423, rs587777798, rs606231306, rs537001725, rs730882237, rs745738628, rs869320680, rs772370177, rs886041004, rs886041907, rs767865405, rs543163491, rs761821795, rs886043110, rs772950604, rs886044083, rs1057516986, rs1057517247, rs773884973, rs1057516258, rs1057517160, rs1057516966, rs370819786, rs750176716, rs766169193, rs1064793673, rs1553618354, rs1555356398, rs141588721, rs1553347936, rs1290836394, rs777437871, rs761071115, rs1554754182, rs1247934219, rs1326631351, rs1250351189, rs757347274, rs1554778005, rs1553342786, rs1301397800, rs374042455, rs1268759044, rs770219373, rs1553163077, rs1553162872, rs1554761310, rs1554766808, rs1554748292, rs1554752805, rs1554761402, rs1309132512, rs1554761462, rs557699482, rs1555738502, rs748087383, rs754403441, rs780433836, rs1569112355, rs1564341846, rs1282726649, rs755487513, rs1057520771, rs756973046, rs1557673817, rs1565899712, rs750453909, rs1572513308, rs1021357430, rs748798133, rs764784497, rs1588112379, rs746823238, rs1575461722, rs780725241, rs760816239, rs2089839448, rs1379052702, rs150877512, rs768144522 23877401
Rheumatoid arthritis Rheumatoid Arthritis rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212 22446963
Schizophrenia Schizophrenia rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313 23904455
Unknown
Disease name Disease term dbSNP ID References
Graves disease Graves Disease 22446963

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412