DRAP1 (DR1 associated protein 1)

Gene

• Entrez ID: 10589
• Gene name: DR1 associated protein 1
• Gene symbol: DRAP1
• Synonyms: NC2-alpha
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020517	hsa-miR-155-5p	Proteomics	18668040
MIRT023515	hsa-miR-1-3p	Proteomics	18668040
MIRT038135	hsa-miR-423-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8670811
GO:0001046	Function	Core promoter sequence-specific DNA binding	IBA	21873635
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IDA	8608938
GO:0001091	Function	RNA polymerase II general transcription initiation factor binding	IPI	8670811
GO:0003677	Function	DNA binding	IDA	8670811
GO:0003713	Function	Transcription coactivator activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 18692475, 21516116, 25416956, 27107012, 29997244, 31467278, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:0006366	Process	Transcription by RNA polymerase II	IBA	21873635
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA	21873635
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	8670811
GO:0017025	Function	TBP-class protein binding	IPI	8670811
GO:0017054	Component	Negative cofactor 2 complex	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	8670811

Other IDs

• MIM: 602289
• HGNC: 3019
• e!Ensembl: ENSG00000175550

Protein

• UniProt ID: Q14919
• Protein name: Dr1-associated corepressor (Dr1-associated protein 1) (Negative cofactor 2-alpha) (NC2-alpha)
• Protein function: The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the
• PDB: 1JFI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00808	CBFD_NFYB_HMF	10 → 74	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	Domain

• Sequence:

  MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
  NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
  NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA
  STLPLPPAPPGPSAPDEEDEEDYDS

• Sequence length: 205

Pathways

Reactome:

Signaling by NODAL
Signaling by Activin

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	22535842