PRDX4 (peroxiredoxin 4)

Gene

• Entrez ID: 10549
• Gene name: Peroxiredoxin 4
• Gene symbol: PRDX4
• Synonyms: AOE37-2, AOE372, HEL-S-97n, PRX-4
• Chromosome: X
• Chromosome location: Xp22.11
• Summary: The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol wi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046583	hsa-miR-222-3p	CLASH	23622248
MIRT041872	hsa-miR-484	CLASH	23622248
MIRT039796	hsa-miR-615-3p	CLASH	23622248
MIRT039796	hsa-miR-615-3p	CLASH	23622248
MIRT039210	hsa-miR-769-5p	CLASH	23622248
MIRT036386	hsa-miR-1229-3p	CLASH	23622248
MIRT052859	hsa-miR-3619-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17644091, 21057456, 21988832, 25959826, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005790	Component	Smooth endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0006979	Process	Response to oxidative stress	IBA	21873635
GO:0007252	Process	I-kappaB phosphorylation	TAS	9388242
GO:0007283	Process	Spermatogenesis	IEA
GO:0008379	Function	Thioredoxin peroxidase activity	IBA	21873635
GO:0008379	Function	Thioredoxin peroxidase activity	TAS	9388242
GO:0008584	Process	Male gonad development	IEA
GO:0018401	Process	Peptidyl-proline hydroxylation to 4-hydroxy-L-proline	IEA
GO:0022417	Process	Protein maturation by protein folding	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0033554	Process	Cellular response to stress	IBA	21873635
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA	21873635
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045454	Process	Cell redox homeostasis	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000255	Process	Negative regulation of male germ cell proliferation	IEA

Other IDs

• MIM: 300927
• HGNC: 17169
• e!Ensembl: ENSG00000123131

Protein

• UniProt ID: Q13162
• Protein name: Peroxiredoxin-4 (EC 1.11.1.24) (Antioxidant enzyme AOE372) (AOE37-2) (Peroxiredoxin IV) (Prx-IV) (Thioredoxin peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Thioredoxin-dependent peroxiredoxin 4)
• Protein function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrog
• PDB: 2PN8, 3TJB, 3TJF, 3TJG, 3TJJ, 3TJK, 3TKP, 3TKQ, 3TKR, 3TKS, 4RQX, 5HQP, 8EKW, 8EKY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00578	AhpC-TSA	81 → 214	AhpC/TSA family	Domain
  PF10417	1-cysPrx_C	234 → 263	C-terminal domain of 1-Cys peroxiredoxin	Domain

• Sequence:

  MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
  PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
  TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
  THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
  HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

• Sequence length: 271

Pathways

Reactome:

Neutrophil degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	16033404
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291	16081686

Unknown
Disease name	Disease term	dbSNP ID	References
Hyperglycemia	Hyperglycemia		20446767