PROCR (protein C receptor)

Gene

• Entrez ID: 10544
• Gene name: Protein C receptor
• Gene symbol: PROCR
• Synonyms: CCCA, CCD41, EPCR
• Chromosome: 20
• Chromosome location: 20q11.22
• Summary: The protein encoded by this gene is a receptor for activated protein C, a serine protease activated by and involved in the blood coagulation pathway. The encoded protein is an N-glycosylated type I membrane protein that enhances the activation of protein C. Mutations in this gene have been associated with venous thromboembolism and myocardial infarction, as well as with late fetal loss during pregnancy. The encoded protein may also play a role in malarial infection and has been associated with cancer. [provided by RefSeq, Jul 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019919	hsa-miR-375	Microarray	20215506
MIRT023818	hsa-miR-1-3p	Proteomics	18668040
MIRT037191	hsa-miR-877-3p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17299037, 20826780
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005813	Component	Centrosome	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	7929370
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007596	Process	Blood coagulation	TAS
GO:0009986	Component	Cell surface	HDA	19581412
GO:0038023	Function	Signaling receptor activity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050819	Process	Negative regulation of coagulation	IBA	21873635
GO:0050819	Process	Negative regulation of coagulation	IMP	19696402
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 600646
• HGNC: 9452
• e!Ensembl: ENSG00000101000

Protein

• UniProt ID: Q9UNN8
• Protein name: Endothelial protein C receptor (Activated protein C receptor) (APC receptor) (Endothelial cell protein C receptor) (CD antigen CD201)
• Protein function: Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.
• PDB: 1L8J, 1LQV, 3JTC, 4V3D, 4V3E, 6SNY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16497	MHC_I_3	1 → 199	MHC-I family domain	Domain

• Sequence:

  MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEG
  PDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCEL
  PPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELRE
  FLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC

• Sequence length: 238

Pathways

KEGG:

Complement and coagulation cascades

Reactome:

Common Pathway of Fibrin Clot Formation
Cell surface interactions at the vascular wall

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778, 28530674, 23202125
Coronary heart disease	Coronary heart disease	rs-1	21966275

Unknown
Disease name	Disease term	dbSNP ID	References
Ischemic stroke	Ischemic stroke	rs6025, rs1799963, rs1799983, rs-1	26908601
Coronary arteriosclerosis	Coronary Arteriosclerosis		28530674
Non rare thrombophilia	NON RARE IN EUROPE: Non rare thrombophilia
Stroke	Cerebrovascular accident		26908601
Thrombosis	Deep Vein Thrombosis		26908601
Ulcerative colitis	Ulcerative Colitis		26192919, 23128233