GediPNet logo

CEBPE (CCAAT enhancer binding protein epsilon)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1053
Gene nameGene Name - the full gene name approved by the HGNC.
CCAAT enhancer binding protein epsilon
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CEBPE
SynonymsGene synonyms aliases
C/EBP-epsilon, CRP1, IMD108, SGD1, c/EBP epsilon
ChromosomeChromosome number
14
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q11.2
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal different
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs760325316 G>A Pathogenic Stop gained, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022958 hsa-miR-124-3p Microarray 18668037
Transcription factors
Transcription factor Regulation Reference
STAT1 Activation 16918696
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10233885
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q15744
Protein name CCAAT/enhancer-binding protein epsilon (C/EBP epsilon)
Protein function Transcriptional activator (PubMed:26019275). C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Required for the promyelocyte-m
PDB 3T92
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2
203 256
Basic region leucine zipper
Coiled-coil
Sequence
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV
KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC
SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM
AENERLRSRVEQLTQE
LDTLRNLFRQIPEAANLIKGVGGCS
Sequence length 281
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Transcriptional misregulation in cancer
Acute myeloid leukemia
 
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591 19684604
Specific granule deficiency Specific granule deficiency, SPECIFIC GRANULE DEFICIENCY 2, SPECIFIC GRANULE DEFICIENCY 1 rs2140292116, rs2140291802, rs1057518731, rs1555580263, rs1057518733, rs760325316, rs112986541 28369034, 29651288, 10359588, 10359588, 10359588, 29651288
Unknown
Disease name Disease term dbSNP ID References
Autoinflammation-immunodeficiency-neutrophil dysfunction syndrome CEBPE-associated autoinflammation-immunodeficiency-neutrophil dysfunction syndrome
Promyelocytic leukemia Acute Promyelocytic Leukemia 16788101

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412