GediPNet logo

CEBPD (CCAAT enhancer binding protein delta)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1052
Gene nameGene Name - the full gene name approved by the HGNC.
CCAAT enhancer binding protein delta
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CEBPD
SynonymsGene synonyms aliases
C/EBP-delta, CELF, CRP3, NF-IL6-beta
ChromosomeChromosome number
8
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q11.21
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulati
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027592 hsa-miR-98-5p Microarray 19088304
MIRT713044 hsa-miR-4999-3p HITS-CLIP 19536157
MIRT713043 hsa-miR-455-3p HITS-CLIP 19536157
MIRT713042 hsa-miR-6516-5p HITS-CLIP 19536157
MIRT713044 hsa-miR-4999-3p HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P49716
Protein name CCAAT/enhancer-binding protein delta (C/EBP delta) (Nuclear factor NF-IL6-beta) (NF-IL6-beta)
Protein function Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300). Important transcription factor regulating the expression of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2
190 243
Basic region leucine zipper
Coiled-coil
Sequence
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRD
LAGLRQFFKQLPSPPFLPAAGTADCR
Sequence length 269
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Interleukin-4 and Interleukin-13 signaling
HCMV Late Events
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601 17234736
Unknown
Disease name Disease term dbSNP ID References
Liver carcinoma Liver carcinoma 14563831
Macroprolactinoma Macroprolactinoma 21980073
Microprolactinoma Microprolactinoma 21980073
Myeloid leukemia Acute Myeloid Leukemia, M1 17234736

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412