CEBPB (CCAAT enhancer binding protein beta)

Gene

• Entrez ID: 1051
• Gene name: CCAAT enhancer binding protein beta
• Gene symbol: CEBPB
• Synonyms: C/EBP-beta, IL6DBP, NF-IL6, TCF5
• Chromosome: 20
• Chromosome location: 20q13.13
• Summary: This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	18367535
MIRT001560	hsa-miR-155-5p	Microarray, qRT-PCR, Western blot	19193853
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	20427544
MIRT001560	hsa-miR-155-5p	pSILAC, Proteomics	18668040
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	19596814
MIRT001560	hsa-miR-155-5p	ELISA, Immunoblot, Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR	19887047
MIRT001560	hsa-miR-155-5p	Western blot	23749759
MIRT001560	hsa-miR-155-5p	Chip, ELISA, Luciferase reporter assay, QRTPCR, Western blot	23612310
MIRT001560	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT005723	hsa-miR-34a-5p	Luciferase reporter assay, Reporter assay	20598588
MIRT006090	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT016122	hsa-miR-421	Sequencing	20371350
MIRT038165	hsa-miR-423-5p	CLASH	23622248
MIRT038165	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25094047
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25784653
MIRT154323	hsa-miR-2116-5p	PAR-CLIP	20371350
MIRT202308	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT202310	hsa-miR-548n	PAR-CLIP	20371350
MIRT202311	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT202313	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT202317	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT235776	hsa-miR-4255	PAR-CLIP	20371350
MIRT296299	hsa-miR-374a-5p	Luciferase reporter assay	23468252
MIRT407003	hsa-miR-4677-5p	PAR-CLIP	20371350
MIRT437806	hsa-let-7c-5p	Luciferase reporter assay	23667114
MIRT564022	hsa-miR-514b-5p	PAR-CLIP	20371350
MIRT564023	hsa-miR-513c-5p	PAR-CLIP	20371350
MIRT564024	hsa-miR-4477a	PAR-CLIP	20371350
MIRT564025	hsa-miR-22-5p	PAR-CLIP	20371350
MIRT564026	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT564027	hsa-miR-371a-5p	PAR-CLIP	20371350
MIRT564028	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT564029	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT564030	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT732461	hsa-miR-21-5p	Luciferase reporter assay, Western blot	25327529
MIRT736557	hsa-miR-1254	PAR-CLIP	26701625
MIRT738236	hsa-miR-185-5p	PAR-CLIP	26701625
MIRT739252	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT739929	hsa-miR-3116	PAR-CLIP	26701625
MIRT740854	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT742627	hsa-miR-374a-3p	PAR-CLIP	26701625
MIRT742794	hsa-miR-382-3p	PAR-CLIP	26701625
MIRT743364	hsa-miR-4254	PAR-CLIP	26701625
MIRT743889	hsa-miR-4306	PAR-CLIP	26701625
MIRT744169	hsa-miR-4419a	PAR-CLIP	26701625
MIRT744394	hsa-miR-4434	PAR-CLIP	26701625
MIRT745608	hsa-miR-4510	PAR-CLIP	26701625
MIRT745747	hsa-miR-4516	PAR-CLIP	26701625
MIRT746362	hsa-miR-4644	PAR-CLIP	26701625
MIRT747004	hsa-miR-4688	PAR-CLIP	26701625
MIRT749095	hsa-miR-486-3p	PAR-CLIP	26701625
MIRT749935	hsa-miR-5192	PAR-CLIP	26701625
MIRT751115	hsa-miR-566	PAR-CLIP	26701625
MIRT751350	hsa-miR-5703	PAR-CLIP	26701625
MIRT752083	hsa-miR-6127	PAR-CLIP	26701625
MIRT752155	hsa-miR-6129	PAR-CLIP	26701625
MIRT752244	hsa-miR-6130	PAR-CLIP	26701625
MIRT752348	hsa-miR-6133	PAR-CLIP	26701625
MIRT753739	hsa-miR-6720-3p	PAR-CLIP	26701625
MIRT754405	hsa-miR-6743-5p	PAR-CLIP	26701625
MIRT754917	hsa-miR-6760-5p	PAR-CLIP	26701625
MIRT758058	hsa-miR-6873-5p	PAR-CLIP	26701625
MIRT758199	hsa-miR-6878-5p	PAR-CLIP	26701625

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	16026328
ESR1	Unknown	19652226

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS	15308669
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	7959007
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	15308669
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001541	Process	Ovarian follicle development	ISS
GO:0001892	Process	Embryonic placenta development	IEA
GO:0003677	Function	DNA binding	TAS	10821850
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10821850
GO:0005515	Function	Protein binding	IPI	7651415, 12692227, 16227626, 17724128, 18820298, 20102225, 20111005, 20829347, 24043631, 31527615
GO:0005634	Component	Nucleus	IDA	20829347
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	20829347
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006953	Process	Acute-phase response	TAS	2112087
GO:0006954	Process	Inflammatory response	TAS	2112087
GO:0006955	Process	Immune response	TAS	2112087
GO:0007613	Process	Memory	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0032675	Process	Regulation of interleukin-6 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	20829347
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035259	Function	Glucocorticoid receptor binding	IEA
GO:0036488	Component	CHOP-C/EBP complex	NAS	15775988
GO:0042130	Process	Negative regulation of T cell proliferation	ISS
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IEA
GO:0045595	Process	Regulation of cell differentiation	IBA	21873635
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	27812542
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	27812542
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7959007
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	14685163
GO:0070169	Process	Positive regulation of biomineral tissue development	IDA	27812542
GO:0070169	Process	Positive regulation of biomineral tissue development	IMP	27812542
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0072574	Process	Hepatocyte proliferation	ISS
GO:0097421	Process	Liver regeneration	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	15762841
GO:1901329	Process	Regulation of odontoblast differentiation	ISS	15308669
GO:1990440	Process	Positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	15775988
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000120	Process	Positive regulation of sodium-dependent phosphate transport	IDA	27812542
GO:2000120	Process	Positive regulation of sodium-dependent phosphate transport	IMP	27812542
GO:2001198	Process	Regulation of dendritic cell differentiation	IEA

Other IDs

• MIM: 189965
• HGNC: 1834
• e!Ensembl: ENSG00000172216

Protein

• UniProt ID: P17676
• Protein name: CCAAT/enhancer-binding protein beta (C/EBP beta) (Liver activator protein) (LAP) (Liver-enriched inhibitory protein) (LIP) (Nuclear factor NF-IL6) (Transcription factor 5) (TCF-5)
• Protein function: Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:1741402, PubMed:9374525, PubMed:12048245, PubMed:18647749). Plays also a significant role in adipogenesis, as well as in the gluconeogenic pathway, liver regeneration, and hematopoiesis. The consensus recognition site is 5'-T[TG]NNGNAA[TG]-3'. Its functional capacity is governed by protein interactions and post-translational protein modifications. During early embryogenesis, plays essential and redundant functions with CEBPA. Has a promitotic effect on many cell types such as hepatocytes and adipocytes but has an antiproliferative effect on T-cells by repressing MYC expression, facilitating differentiation along the T-helper 2 lineage. Binds to regulatory regions of several acute-phase and cytokines genes and plays a role in the regulation of acute-phase reaction and inflammation. Plays also a role in intracellular bacteria killing (By similarity). During adipogenesis, is rapidly expressed and, after activation by phosphorylation, induces CEBPA and PPARG, which turn on the series of adipocyte genes that give rise to the adipocyte phenotype. The delayed transactivation of the CEBPA and PPARG genes by CEBPB appears necessary to allow mitotic clonal expansion and thereby progression of terminal differentiation (PubMed:20829347). Essential for female reproduction because of a critical role in ovarian follicle development (By similarity). Restricts osteoclastogenesis: together with NFE2L1; represses expression of DSPP during odontoblast differentiation (By similarity). ; [Isoform 2]: Essential for gene expression induction in activated macrophages. Plays a major role in immune responses such as CD4(+) T-cell response, granuloma formation and endotoxin shock. Not essential for intracellular bacteria killing. ; [Isoform 3]: Acts as a dominant negative through heterodimerization with isoform 2 (PubMed:11741938). Promotes osteoblast differentiation and osteoclastogenesis (By similarity).
• PDB: 1GTW, 1GU4, 1GU5, 1H88, 1H89, 1H8A, 1HJB, 1IO4, 2E42, 2E43, 6MG1, 6MG2, 6MG3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07716	bZIP_2	270 → 323	Basic region leucine zipper	Coiled-coil

• Sequence:

  MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
  GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
  LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
  PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
  AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
  HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

• Sequence length: 345

Pathways

KEGG:

Efferocytosis
IL-17 signaling pathway
TNF signaling pathway
Tuberculosis
Transcriptional misregulation in cancer

Reactome:

Senescence-Associated Secretory Phenotype (SASP)
Transcriptional regulation of white adipocyte differentiation
Transcriptional Regulation by VENTX
Response of EIF2AK4 (GCN2) to amino acid deficiency
Response of EIF2AK1 (HRI) to heme deficiency

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	17177178

Unknown
Disease name	Disease term	dbSNP ID	References
Alveolitis	Alveolitis, Fibrosing		17177178
Cerebral ischemia	Brain Ischemia		17394460
Fatty liver	Fatty Liver, Steatohepatitis		24469900
Liver carcinoma	Liver carcinoma		14563831
Subfertility	Subfertility, Female		21177758