GediPNet logo

CEBPB (CCAAT enhancer binding protein beta)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1051
Gene nameGene Name - the full gene name approved by the HGNC.
CCAAT enhancer binding protein beta
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CEBPB
SynonymsGene synonyms aliases
C/EBP-beta, IL6DBP, NF-IL6, TCF5
ChromosomeChromosome number
20
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.13
SummarySummary of gene provided in NCBI Entrez Gene.
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of t
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001560 hsa-miR-155-5p Luciferase reporter assay 18367535
MIRT001560 hsa-miR-155-5p Review 20029422
MIRT001560 hsa-miR-155-5p Luciferase reporter assay, qRT-PCR, Western blot 20427544
MIRT001560 hsa-miR-155-5p pSILAC 18668040
MIRT001560 hsa-miR-155-5p Microarray, qRT-PCR, Western blot 19193853
Transcription factors
Transcription factor Regulation Reference
ATF4 Activation 16026328
ESR1 Unknown 19652226
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS 15308669
GO:0000779 Component Condensed chromosome, centromeric region IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 7959007
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P17676
Protein name CCAAT/enhancer-binding protein beta (C/EBP beta) (Liver activator protein) (LAP) (Liver-enriched inhibitory protein) (LIP) (Nuclear factor NF-IL6) (Transcription factor 5) (TCF-5)
Protein function Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:12048245, PubMed:1741402, PubMed:18647749, PubMed:9374525). Also plays a significant role in adipogenesis, as well as in the
PDB 1GTW , 1GU4 , 1GU5 , 1H88 , 1H89 , 1H8A , 1HJB , 1IO4 , 2E42 , 2E43 , 6MG1 , 6MG2 , 6MG3 , 7L4V , 7UPZ , 8K8D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2
270 323
Basic region leucine zipper
Coiled-coil
Sequence
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRE
LSTLRNLFKQLPEPLLASSGHC
Sequence length 345
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Efferocytosis
IL-17 signaling pathway
TNF signaling pathway
Tuberculosis
Transcriptional misregulation in cancer
  Senescence-Associated Secretory Phenotype (SASP)
Transcriptional regulation of white adipocyte differentiation
Transcriptional Regulation by VENTX
Response of EIF2AK4 (GCN2) to amino acid deficiency
Response of EIF2AK1 (HRI) to heme deficiency
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Pulmonary fibrosis Pulmonary Fibrosis rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 17177178
Unknown
Disease name Disease term dbSNP ID References
Alveolitis Alveolitis, Fibrosing 17177178
Cerebral ischemia Brain Ischemia 17394460
Fatty liver Fatty Liver, Steatohepatitis 24469900
Liver carcinoma Liver carcinoma 14563831

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412