CEBPA (CCAAT enhancer binding protein alpha)

Gene

• Entrez ID: 1050
• Gene name: CCAAT enhancer binding protein alpha
• Gene symbol: CEBPA
• Synonyms: C/EBP-alpha, CEBP
• Chromosome: 19
• Chromosome location: 19q13.11
• Summary: This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002025	hsa-miR-124-3p	Western blot, Reporter assay	18451139
MIRT002025	hsa-miR-124-3p	Luciferase reporter assay	18451139
MIRT000390	hsa-miR-1-3p	Luciferase reporter assay	18818206
MIRT002025	hsa-miR-124-3p	Review	20029422
MIRT002025	hsa-miR-124-3p	Review	20029422
MIRT002025	hsa-miR-124-3p	Microarray	15685193
MIRT005488	hsa-miR-138-5p	qRT-PCR	20486779
MIRT045932	hsa-miR-125b-5p	CLASH	23622248
MIRT038606	hsa-miR-193a-5p	CLASH	23622248
MIRT037622	hsa-miR-744-5p	CLASH	23622248
MIRT036497	hsa-miR-1226-3p	CLASH	23622248
MIRT045932	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25982911
MIRT883192	hsa-miR-124	CLIP-seq
MIRT883193	hsa-miR-1256	CLIP-seq
MIRT883194	hsa-miR-1269	CLIP-seq
MIRT883195	hsa-miR-1269b	CLIP-seq
MIRT883196	hsa-miR-1271	CLIP-seq
MIRT883197	hsa-miR-1288	CLIP-seq
MIRT883198	hsa-miR-154	CLIP-seq
MIRT883199	hsa-miR-182	CLIP-seq
MIRT883200	hsa-miR-1827	CLIP-seq
MIRT883201	hsa-miR-199a-3p	CLIP-seq
MIRT883202	hsa-miR-199b-3p	CLIP-seq
MIRT883203	hsa-miR-22	CLIP-seq
MIRT883204	hsa-miR-31	CLIP-seq
MIRT883205	hsa-miR-3129-5p	CLIP-seq
MIRT883206	hsa-miR-3163	CLIP-seq
MIRT883207	hsa-miR-3173-3p	CLIP-seq
MIRT883208	hsa-miR-3184	CLIP-seq
MIRT883209	hsa-miR-33a	CLIP-seq
MIRT883210	hsa-miR-33b	CLIP-seq
MIRT883211	hsa-miR-3612	CLIP-seq
MIRT883212	hsa-miR-361-3p	CLIP-seq
MIRT883213	hsa-miR-3616-3p	CLIP-seq
MIRT883214	hsa-miR-3622a-5p	CLIP-seq
MIRT883215	hsa-miR-3662	CLIP-seq
MIRT883216	hsa-miR-3667-3p	CLIP-seq
MIRT883217	hsa-miR-3672	CLIP-seq
MIRT883218	hsa-miR-3676	CLIP-seq
MIRT883219	hsa-miR-3679-3p	CLIP-seq
MIRT883220	hsa-miR-3713	CLIP-seq
MIRT883221	hsa-miR-384	CLIP-seq
MIRT883222	hsa-miR-3910	CLIP-seq
MIRT883223	hsa-miR-3925-5p	CLIP-seq
MIRT883224	hsa-miR-423-5p	CLIP-seq
MIRT883225	hsa-miR-4326	CLIP-seq
MIRT883226	hsa-miR-4428	CLIP-seq
MIRT883227	hsa-miR-4457	CLIP-seq
MIRT883228	hsa-miR-4492	CLIP-seq
MIRT883229	hsa-miR-4493	CLIP-seq
MIRT883230	hsa-miR-4496	CLIP-seq
MIRT883231	hsa-miR-4498	CLIP-seq
MIRT883232	hsa-miR-4515	CLIP-seq
MIRT883233	hsa-miR-4533	CLIP-seq
MIRT883234	hsa-miR-4540	CLIP-seq
MIRT883235	hsa-miR-4690-3p	CLIP-seq
MIRT883236	hsa-miR-4695-5p	CLIP-seq
MIRT883237	hsa-miR-4713-5p	CLIP-seq
MIRT883238	hsa-miR-4721	CLIP-seq
MIRT883239	hsa-miR-4728-3p	CLIP-seq
MIRT883240	hsa-miR-4740-5p	CLIP-seq
MIRT883241	hsa-miR-4743	CLIP-seq
MIRT883242	hsa-miR-4747-5p	CLIP-seq
MIRT883243	hsa-miR-4797-3p	CLIP-seq
MIRT883244	hsa-miR-506	CLIP-seq
MIRT883245	hsa-miR-510	CLIP-seq
MIRT883246	hsa-miR-512-5p	CLIP-seq
MIRT883247	hsa-miR-554	CLIP-seq
MIRT883248	hsa-miR-589	CLIP-seq
MIRT883249	hsa-miR-615-3p	CLIP-seq
MIRT883250	hsa-miR-624	CLIP-seq
MIRT883251	hsa-miR-650	CLIP-seq
MIRT883252	hsa-miR-670	CLIP-seq
MIRT883253	hsa-miR-762	CLIP-seq
MIRT883254	hsa-miR-936	CLIP-seq
MIRT883255	hsa-miR-940	CLIP-seq
MIRT883256	hsa-miR-96	CLIP-seq
MIRT1961874	hsa-miR-101	CLIP-seq
MIRT1961875	hsa-miR-1225-3p	CLIP-seq
MIRT1961876	hsa-miR-1233	CLIP-seq
MIRT883194	hsa-miR-1269	CLIP-seq
MIRT883195	hsa-miR-1269b	CLIP-seq
MIRT883197	hsa-miR-1288	CLIP-seq
MIRT1961877	hsa-miR-144	CLIP-seq
MIRT883198	hsa-miR-154	CLIP-seq
MIRT1961878	hsa-miR-28-3p	CLIP-seq
MIRT883211	hsa-miR-3612	CLIP-seq
MIRT883218	hsa-miR-3676	CLIP-seq
MIRT883221	hsa-miR-384	CLIP-seq
MIRT883222	hsa-miR-3910	CLIP-seq
MIRT1961879	hsa-miR-4267	CLIP-seq
MIRT1961880	hsa-miR-4270	CLIP-seq
MIRT1961881	hsa-miR-4271	CLIP-seq
MIRT1961882	hsa-miR-4290	CLIP-seq
MIRT1961883	hsa-miR-4323	CLIP-seq
MIRT883225	hsa-miR-4326	CLIP-seq
MIRT1961884	hsa-miR-4434	CLIP-seq
MIRT1961885	hsa-miR-4441	CLIP-seq
MIRT883227	hsa-miR-4457	CLIP-seq
MIRT883228	hsa-miR-4492	CLIP-seq
MIRT883229	hsa-miR-4493	CLIP-seq
MIRT883231	hsa-miR-4498	CLIP-seq
MIRT1961886	hsa-miR-4505	CLIP-seq
MIRT883232	hsa-miR-4515	CLIP-seq
MIRT1961887	hsa-miR-4516	CLIP-seq
MIRT1961888	hsa-miR-4667-3p	CLIP-seq
MIRT1961889	hsa-miR-4687-5p	CLIP-seq
MIRT883235	hsa-miR-4690-3p	CLIP-seq
MIRT1961890	hsa-miR-4690-5p	CLIP-seq
MIRT1961891	hsa-miR-4695-3p	CLIP-seq
MIRT883236	hsa-miR-4695-5p	CLIP-seq
MIRT883237	hsa-miR-4713-5p	CLIP-seq
MIRT1961892	hsa-miR-4725-3p	CLIP-seq
MIRT883239	hsa-miR-4728-3p	CLIP-seq
MIRT1961893	hsa-miR-4731-5p	CLIP-seq
MIRT883240	hsa-miR-4740-5p	CLIP-seq
MIRT1961894	hsa-miR-4786-3p	CLIP-seq
MIRT883250	hsa-miR-624	CLIP-seq
MIRT883251	hsa-miR-650	CLIP-seq
MIRT883252	hsa-miR-670	CLIP-seq
MIRT883253	hsa-miR-762	CLIP-seq
MIRT883192	hsa-miR-124	CLIP-seq
MIRT883196	hsa-miR-1271	CLIP-seq
MIRT2198431	hsa-miR-139-3p	CLIP-seq
MIRT2198432	hsa-miR-181a	CLIP-seq
MIRT2198433	hsa-miR-181b	CLIP-seq
MIRT2198434	hsa-miR-181c	CLIP-seq
MIRT2198435	hsa-miR-181d	CLIP-seq
MIRT883199	hsa-miR-182	CLIP-seq
MIRT2198436	hsa-miR-23a	CLIP-seq
MIRT2198437	hsa-miR-23b	CLIP-seq
MIRT2198438	hsa-miR-23c	CLIP-seq
MIRT2198439	hsa-miR-25	CLIP-seq
MIRT2198440	hsa-miR-299-5p	CLIP-seq
MIRT2198441	hsa-miR-300	CLIP-seq
MIRT883204	hsa-miR-31	CLIP-seq
MIRT883206	hsa-miR-3163	CLIP-seq
MIRT2198442	hsa-miR-32	CLIP-seq
MIRT2198443	hsa-miR-323-5p	CLIP-seq
MIRT2198444	hsa-miR-363	CLIP-seq
MIRT883215	hsa-miR-3662	CLIP-seq
MIRT2198445	hsa-miR-367	CLIP-seq
MIRT883220	hsa-miR-3713	CLIP-seq
MIRT2198446	hsa-miR-381	CLIP-seq
MIRT2198447	hsa-miR-3939	CLIP-seq
MIRT2198448	hsa-miR-4262	CLIP-seq
MIRT883227	hsa-miR-4457	CLIP-seq
MIRT2198449	hsa-miR-4524	CLIP-seq
MIRT1961893	hsa-miR-4731-5p	CLIP-seq
MIRT2198450	hsa-miR-486-3p	CLIP-seq
MIRT883244	hsa-miR-506	CLIP-seq
MIRT2198451	hsa-miR-522	CLIP-seq
MIRT2198452	hsa-miR-548aa	CLIP-seq
MIRT2198453	hsa-miR-548p	CLIP-seq
MIRT883249	hsa-miR-615-3p	CLIP-seq
MIRT2198454	hsa-miR-876-3p	CLIP-seq
MIRT2198455	hsa-miR-92a	CLIP-seq
MIRT2198456	hsa-miR-92b	CLIP-seq
MIRT883256	hsa-miR-96	CLIP-seq
MIRT883228	hsa-miR-4492	CLIP-seq
MIRT883231	hsa-miR-4498	CLIP-seq
MIRT1961886	hsa-miR-4505	CLIP-seq
MIRT1961893	hsa-miR-4731-5p	CLIP-seq
MIRT883253	hsa-miR-762	CLIP-seq
MIRT1961880	hsa-miR-4270	CLIP-seq
MIRT1961884	hsa-miR-4434	CLIP-seq
MIRT1961885	hsa-miR-4441	CLIP-seq
MIRT1961887	hsa-miR-4516	CLIP-seq
MIRT1961894	hsa-miR-4786-3p	CLIP-seq
MIRT1961880	hsa-miR-4270	CLIP-seq
MIRT1961884	hsa-miR-4434	CLIP-seq
MIRT1961885	hsa-miR-4441	CLIP-seq
MIRT1961887	hsa-miR-4516	CLIP-seq
MIRT1961894	hsa-miR-4786-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DDIT3	Repression	21983012
GATA1	Repression	19825991
LEF1	Unknown	19620402
MYB	Unknown	10706719
MYC	Repression	19259613
MYC	Unknown	15867211
PPARG	Unknown	15867211
ZBTB16	Unknown	19723763

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000050	Process	Urea cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	12695546, 28186500
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16946298
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001889	Process	Liver development	ISS
GO:0001892	Process	Embryonic placenta development	IEA
GO:0003677	Function	DNA binding	TAS	8643605
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11242107, 12695546, 15664994
GO:0005515	Function	Protein binding	IPI	12692227, 15107404, 16490787, 19059241, 20102225, 23814099
GO:0005634	Component	Nucleus	IDA	11242107
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IDA	24429361
GO:0005730	Component	Nucleolus	IEA
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	8643605
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	15664994
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0008134	Function	Transcription factor binding	IPI	15664994, 24429361
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14660596
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0016032	Process	Viral process	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	15664994
GO:0019900	Function	Kinase binding	IPI	15107404
GO:0030099	Process	Myeloid cell differentiation	IBA	21873635
GO:0030099	Process	Myeloid cell differentiation	NAS	15664994
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030324	Process	Lung development	ISS
GO:0030851	Process	Granulocyte differentiation	ISS
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	TAS	14685163
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	14685163
GO:0045892	Process	Negative regulation of transcription, DNA-templated	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7959007, 20972335
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	24429361
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16946298
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IDA	12695546
GO:0048469	Process	Cell maturation	IEA
GO:0048839	Process	Inner ear development	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055088	Process	Lipid homeostasis	ISS
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	24429361
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IMP	16946298

Other IDs

• MIM: 116897
• HGNC: 1833
• e!Ensembl: ENSG00000245848

Protein

• UniProt ID: P49715
• Protein name: CCAAT/enhancer-binding protein alpha (C/EBP alpha)
• Protein function: Transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. Binds directly to the consensus DNA sequence 5'-T[TG]NNGNAA[TG]-3' acting
• PDB: 6DC0, 8K8C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07716	bZIP_2	281 → 334	Basic region leucine zipper	Coiled-coil

• Sequence:

  MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
  SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM
  PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
  YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA
  LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
  DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

• Sequence length: 358

Pathways

KEGG:

Non-alcoholic fatty liver disease
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia

Reactome:

Transcriptional regulation of white adipocyte differentiation
Transcriptional regulation of granulopoiesis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Acute myeloid leukemia	Childhood Acute Myeloid Leukemia	rs121434637, rs587776710, rs121912660, rs606231202, rs121434595, rs587776806, rs1554138188, rs1554138189, rs77375493, rs121912472, rs398122514, rs121909646, rs121913488, rs121913486, rs587776848, rs121912791, rs28931590, rs1555741948, rs1555741967, rs587776849, rs137852728, rs1555760738, rs724159947, rs797046041, rs762890562, rs863224451, rs147001633, rs377577594, rs121913499, rs121913487, rs377023736, rs1057519750, rs765848205, rs112832879, rs1057520339, rs876660821, rs1060502121, rs779626155, rs1131691004, rs1555742213, rs1555742295, rs1555903332, rs1561878500, rs1600023511, rs1600023950, rs1573338559, rs1569084106, rs1388478228, rs1967195832, rs1601333612	19953636
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	17510391, 21346772
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	23716546, 15902292, 18987666, 26721895, 19953636, 11242107, 10397723, 30563700, 18946494, 12661007, 19822134, 21177436, 18768433, 21455213, 1391942, 26162409, 30420649, 28297620, 15575056, 18394553, 27069254, 18987666, 30420649, 19822134
Myelodysplastic syndrome	MYELODYSPLASTIC SYNDROME	rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	28242765
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	29078374

Unknown
Disease name	Disease term	dbSNP ID	References
Alveolitis	Alveolitis, Fibrosing		29078374
Head and neck neoplasms	Head and Neck Neoplasms		17510391
Head neoplasms	Head Neoplasms		17510391
Neck cancer	Cancer of Neck		17510391
Neoplasm of head	Cancer of Head		17510391
Liver carcinoma	Liver carcinoma		16288022, 21785164
Head and neck cancer	Malignant Head and Neck Neoplasm	rs762384959, rs16879870, rs2761591, rs2641256, rs854936	17510391
Monocytic leukemia	Acute monocytic leukemia		28297620
Myeloblastic leukemia	Adult Acute Myeloblastic Leukemia		19953636
Myeloid leukemia	Acute Myeloid Leukemia, M1, Inherited acute myeloid leukemia		19822134, 18987666, 30420649, 22649106
Myeloid leukemia with cebpa somatic mutations	Acute myeloid leukemia with CEBPA somatic mutations		19357394, 22649106
Myeloid leukemia with t(8;21)(q22;q22) translocation	Acute myeloid leukemia with t(8;21)(q22;q22) translocation
Neck neoplasms	Neck Neoplasms		17510391
Promyelocytic leukemia	Acute Promyelocytic Leukemia		16788101, 26285909
Radiation-induced cancer	Radiation-Induced Cancer		21346772
Skin cancer	Malignant neoplasm of skin		21346772
Skin neoplasms	Skin Neoplasms		21346772
Subfertility	Subfertility, Female		21177758
Upper aerodigestive tract neoplasms	Upper Aerodigestive Tract Neoplasms		17510391