GediPNet logo

CEBPA (CCAAT enhancer binding protein alpha)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1050
Gene nameGene Name - the full gene name approved by the HGNC.
CCAAT enhancer binding protein alpha
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CEBPA
SynonymsGene synonyms aliases
C/EBP-alpha, CEBP
ChromosomeChromosome number
19
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.11
SummarySummary of gene provided in NCBI Entrez Gene.
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-b
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002025 hsa-miR-124-3p Western blot, Reporter assay 18451139
MIRT002025 hsa-miR-124-3p Luciferase reporter assay 18451139
MIRT000390 hsa-miR-1-3p Luciferase reporter assay 18818206
MIRT002025 hsa-miR-124-3p Review 20029422
MIRT002025 hsa-miR-124-3p Review 20029422
Transcription factors
Transcription factor Regulation Reference
DDIT3 Repression 21983012
GATA1 Repression 19825991
LEF1 Unknown 19620402
MYB Unknown 10706719
MYC Repression 19259613
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000050 Process Urea cycle IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 12695546, 28186500
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P49715
Protein name CCAAT/enhancer-binding protein alpha (C/EBP alpha)
Protein function Transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. Binds directly to the consensus DNA sequence 5'-T[TG]NNGNAA[TG]-3' acting
PDB 6DC0 , 8K8C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2
281 334
Basic region leucine zipper
Coiled-coil
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM
PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA
LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRE
LDTLRGIFRQLPESSLVKAMGNCA
Sequence length 358
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Non-alcoholic fatty liver disease
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
  Transcriptional regulation of white adipocyte differentiation
Transcriptional regulation of granulopoiesis
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Acute myeloid leukemia Childhood Acute Myeloid Leukemia rs121434637, rs587776710, rs121912660, rs606231202, rs121434595, rs587776806, rs1554138188, rs1554138189, rs77375493, rs121912472, rs398122514, rs121909646, rs121913488, rs121913486, rs587776848, rs121912791, rs28931590, rs1555741948, rs1555741967, rs587776849, rs137852728, rs1555760738, rs724159947, rs797046041, rs762890562, rs863224451, rs147001633, rs377577594, rs121913499, rs121913487, rs377023736, rs1057519750, rs765848205, rs112832879, rs1057520339, rs876660821, rs1060502121, rs779626155, rs1131691004, rs1555742213, rs1555742295, rs1555903332, rs1561878500, rs1600023511, rs1600023950, rs1573338559, rs1569084106, rs1388478228, rs1967195832, rs1601333612 19953636
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 17510391, 21346772
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601 23716546, 15902292, 18987666, 26721895, 19953636, 11242107, 10397723, 30563700, 18946494, 12661007, 19822134, 21177436, 18768433, 21455213, 1391942, 26162409, 30420649, 28297620, 15575056, 18394553, 27069254, 18987666, 30420649, 19822134
Myelodysplastic syndrome MYELODYSPLASTIC SYNDROME rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587
Unknown
Disease name Disease term dbSNP ID References
Alveolitis Alveolitis, Fibrosing 29078374
Head and neck neoplasms Head and Neck Neoplasms 17510391
Head neoplasms Head Neoplasms 17510391
Neck cancer Cancer of Neck 17510391

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412