IFI30 (IFI30 lysosomal thiol reductase)

Gene

• Entrez ID: 10437
• Gene name: IFI30 lysosomal thiol reductase
• Gene symbol: IFI30
• Synonyms: GILT, IFI-30, IP-30, IP30
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045663	hsa-miR-149-5p	CLASH	23622248
MIRT1060202	hsa-miR-1182	CLIP-seq
MIRT1060203	hsa-miR-1285	CLIP-seq
MIRT1060204	hsa-miR-145	CLIP-seq
MIRT1060205	hsa-miR-2113	CLIP-seq
MIRT1060206	hsa-miR-2681	CLIP-seq
MIRT1060207	hsa-miR-29a	CLIP-seq
MIRT1060208	hsa-miR-29b	CLIP-seq
MIRT1060209	hsa-miR-29c	CLIP-seq
MIRT1060210	hsa-miR-3126-3p	CLIP-seq
MIRT1060211	hsa-miR-3163	CLIP-seq
MIRT1060212	hsa-miR-3180-5p	CLIP-seq
MIRT1060213	hsa-miR-3187-5p	CLIP-seq
MIRT1060214	hsa-miR-342-5p	CLIP-seq
MIRT1060215	hsa-miR-3665	CLIP-seq
MIRT1060216	hsa-miR-3681	CLIP-seq
MIRT1060217	hsa-miR-378g	CLIP-seq
MIRT1060218	hsa-miR-4282	CLIP-seq
MIRT1060219	hsa-miR-4320	CLIP-seq
MIRT1060220	hsa-miR-4460	CLIP-seq
MIRT1060221	hsa-miR-4486	CLIP-seq
MIRT1060222	hsa-miR-4651	CLIP-seq
MIRT1060223	hsa-miR-4664-5p	CLIP-seq
MIRT1060224	hsa-miR-4690-5p	CLIP-seq
MIRT1060225	hsa-miR-4727-3p	CLIP-seq
MIRT1060226	hsa-miR-4782-5p	CLIP-seq
MIRT1060227	hsa-miR-526b	CLIP-seq
MIRT1060228	hsa-miR-562	CLIP-seq
MIRT1060229	hsa-miR-599	CLIP-seq
MIRT1060230	hsa-miR-608	CLIP-seq
MIRT1060231	hsa-miR-612	CLIP-seq
MIRT1060232	hsa-miR-764	CLIP-seq
MIRT1060233	hsa-miR-767-5p	CLIP-seq
MIRT2014082	hsa-miR-1260	CLIP-seq
MIRT2014083	hsa-miR-1260b	CLIP-seq
MIRT2014084	hsa-miR-188-3p	CLIP-seq
MIRT2014085	hsa-miR-3156-3p	CLIP-seq
MIRT2014086	hsa-miR-383	CLIP-seq
MIRT2014087	hsa-miR-4301	CLIP-seq
MIRT1060207	hsa-miR-29a	CLIP-seq
MIRT1060208	hsa-miR-29b	CLIP-seq
MIRT1060209	hsa-miR-29c	CLIP-seq
MIRT1060216	hsa-miR-3681	CLIP-seq
MIRT1060219	hsa-miR-4320	CLIP-seq
MIRT1060220	hsa-miR-4460	CLIP-seq
MIRT1060222	hsa-miR-4651	CLIP-seq
MIRT1060225	hsa-miR-4727-3p	CLIP-seq
MIRT1060227	hsa-miR-526b	CLIP-seq
MIRT1060230	hsa-miR-608	CLIP-seq
MIRT1060233	hsa-miR-767-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005764	Component	Lysosome	IBA	21873635
GO:0005764	Component	Lysosome	IDA	10639150
GO:0005829	Component	Cytosol	IDA
GO:0016491	Function	Oxidoreductase activity	IBA	21873635
GO:0016667	Function	Oxidoreductase activity, acting on a sulfur group of donors	EXP	10639150, 17142755
GO:0016667	Function	Oxidoreductase activity, acting on a sulfur group of donors	IBA	21873635
GO:0016667	Function	Oxidoreductase activity, acting on a sulfur group of donors	IMP	10639150
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0030054	Component	Cell junction	IDA
GO:0042590	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I	ISS
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS

Other IDs

• MIM: 604664
• HGNC: 5398
• e!Ensembl: ENSG00000216490

Protein

• UniProt ID: P13284
• Protein name: Gamma-interferon-inducible lysosomal thiol reductase (EC 1.8.-.-) (Gamma-interferon-inducible protein IP-30) (Legumaturain)
• Protein function: Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-re
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03227	GILT	63 → 166	Gamma interferon inducible lysosomal thiol reductase (GILT)	Family

• Sequence:

  MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAP
  LVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHG
  EEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAM
  GDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSS
  TSSLRSVCFK

• Sequence length: 250

Pathways

KEGG:

Antigen processing and presentation

Reactome:

MHC class II antigen presentation
Interferon gamma signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	17597826
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	17330099
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	24076602

Unknown
Disease name	Disease term	dbSNP ID	References
Myeloid leukemia	Acute Myeloid Leukemia, M1		17330099