CLEC4M (C-type lectin domain family 4 member M)

Gene

• Entrez ID: 10332
• Gene name: C-type lectin domain family 4 member M
• Gene symbol: CLEC4M
• Synonyms: CD209L, CD299, DC-SIGN2, DC-SIGNR, DCSIGNR, HP10347, L-SIGN, LSIGN
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT896132	hsa-miR-2392	CLIP-seq
MIRT896133	hsa-miR-297	CLIP-seq
MIRT896134	hsa-miR-3149	CLIP-seq
MIRT896135	hsa-miR-3151	CLIP-seq
MIRT896136	hsa-miR-3190	CLIP-seq
MIRT896137	hsa-miR-4447	CLIP-seq
MIRT896138	hsa-miR-4472	CLIP-seq
MIRT896139	hsa-miR-4640-5p	CLIP-seq
MIRT896140	hsa-miR-4651	CLIP-seq
MIRT896141	hsa-miR-4726-5p	CLIP-seq
MIRT896142	hsa-miR-4731-3p	CLIP-seq
MIRT896143	hsa-miR-4801	CLIP-seq
MIRT896144	hsa-miR-4802-5p	CLIP-seq
MIRT896145	hsa-miR-491-5p	CLIP-seq
MIRT896146	hsa-miR-608	CLIP-seq
MIRT896147	hsa-miR-7	CLIP-seq
MIRT2504475	hsa-miR-4468	CLIP-seq
MIRT2504475	hsa-miR-4468	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	15496474, 24623090
GO:0001618	Function	Virus receptor activity	IMP	15496474
GO:0002250	Process	Adaptive immune response	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32607506, 32766577
GO:0005537	Function	Mannose binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	NAS	11337487
GO:0005887	Component	Integral component of plasma membrane	TAS	10072769
GO:0006897	Process	Endocytosis	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	NAS	11337487
GO:0009988	Process	Cell-cell recognition	TAS	11337487
GO:0016020	Component	Membrane	TAS	11337487
GO:0019048	Process	Modulation by virus of host process	TAS	11337487
GO:0019062	Process	Virion attachment to host cell	TAS	11337487
GO:0019079	Process	Viral genome replication	NAS	11337487
GO:0019882	Process	Antigen processing and presentation	NAS	11337487
GO:0030246	Function	Carbohydrate binding	NAS	11337487
GO:0030369	Function	ICAM-3 receptor activity	NAS	11257134
GO:0035556	Process	Intracellular signal transduction	NAS	11337487
GO:0038023	Function	Signaling receptor activity	NAS	11257134
GO:0042605	Function	Peptide antigen binding	NAS	11337487
GO:0043657	Component	Host cell	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046718	Process	Viral entry into host cell	IDA	24623090
GO:0046790	Function	Virion binding	TAS	11337487
GO:0046872	Function	Metal ion binding	IEA
GO:0046968	Process	Peptide antigen transport	NAS	11337487
GO:0048306	Function	Calcium-dependent protein binding	IPI	12609975
GO:0075733	Process	Intracellular transport of virus	TAS	11337487

Other IDs

• MIM: 605872
• HGNC: 13523
• e!Ensembl: ENSG00000104938

Protein

• UniProt ID: Q9H2X3
• Protein name: C-type lectin domain family 4 member M (CD209 antigen-like protein 1) (DC-SIGN-related protein) (DC-SIGNR) (Dendritic cell-specific ICAM-3-grabbing non-integrin 2) (DC-SIGN2) (Liver/lymph node-specific ICAM-3-grabbing non-integrin) (L-SIGN) (CD antigen CD
• Protein function: Probable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Is a receptor for ICAM3, probably by binding to manno
• PDB: 1K9J, 1SL6, 1XAR, 1XPH, 3JQH, 8RCY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	285 → 391	Lectin C-type domain	Domain

• Sequence:

  MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFML
  LAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLK
  AAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQE
  IYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGE
  LPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVR
  AQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEP
  NNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

• Sequence length: 399

Pathways

KEGG:

Virion - Human immunodeficiency virus
Virion - Flavivirus and Alphavirus
Virion - Ebolavirus, Lyssavirus and Morbillivirus
Virion - Lassa virus and SFTS virus
Phagosome
C-type lectin receptor signaling pathway
Tuberculosis
Measles

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560