GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

CDKN3 (cyclin dependent kinase inhibitor 3)

Gene

1033

Cyclin dependent kinase inhibitor 3

CDKN3

CDI1, CIP2, KAP, KAP1

14q22.2

The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK

Show/Hide all(125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005705	hsa-miR-146a-5p	Western blot	19944095
MIRT024518	hsa-miR-215-5p	Microarray	19074876
MIRT026751	hsa-miR-192-5p	Microarray	19074876
MIRT049159	hsa-miR-92a-3p	CLASH	23622248
MIRT642630	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642629	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT642628	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT642627	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT642626	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642625	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT642624	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT642623	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642622	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT642621	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT642620	hsa-miR-4284	HITS-CLIP	23824327
MIRT642619	hsa-miR-7641	HITS-CLIP	23824327
MIRT642618	hsa-miR-3689d	HITS-CLIP	23824327
MIRT642617	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT642630	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642629	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT642628	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT642627	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT642626	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642625	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT642624	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT642623	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642622	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT642621	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT642620	hsa-miR-4284	HITS-CLIP	23824327
MIRT642619	hsa-miR-7641	HITS-CLIP	23824327
MIRT642618	hsa-miR-3689d	HITS-CLIP	23824327
MIRT642617	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881904	hsa-miR-1324	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881907	hsa-miR-3942-3p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881910	hsa-miR-548a-3p	CLIP-seq
MIRT881911	hsa-miR-548e	CLIP-seq
MIRT881912	hsa-miR-548f	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881904	hsa-miR-1324	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT881907	hsa-miR-3942-3p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881910	hsa-miR-548a-3p	CLIP-seq
MIRT881911	hsa-miR-548e	CLIP-seq
MIRT881912	hsa-miR-548f	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq
MIRT881888	hsa-miR-1297	CLIP-seq
MIRT881889	hsa-miR-141	CLIP-seq
MIRT2198004	hsa-miR-146a	CLIP-seq
MIRT2198005	hsa-miR-146b-5p	CLIP-seq
MIRT881890	hsa-miR-181a	CLIP-seq
MIRT881891	hsa-miR-181b	CLIP-seq
MIRT881892	hsa-miR-181c	CLIP-seq
MIRT881893	hsa-miR-181d	CLIP-seq
MIRT881894	hsa-miR-200a	CLIP-seq
MIRT881895	hsa-miR-26a	CLIP-seq
MIRT881896	hsa-miR-26b	CLIP-seq
MIRT2198006	hsa-miR-3123	CLIP-seq
MIRT881905	hsa-miR-3130-3p	CLIP-seq
MIRT881906	hsa-miR-3146	CLIP-seq
MIRT881897	hsa-miR-3161	CLIP-seq
MIRT881898	hsa-miR-323-5p	CLIP-seq
MIRT2198007	hsa-miR-3925-5p	CLIP-seq
MIRT881899	hsa-miR-4262	CLIP-seq
MIRT881900	hsa-miR-4456	CLIP-seq
MIRT881901	hsa-miR-4465	CLIP-seq
MIRT881908	hsa-miR-4686	CLIP-seq
MIRT881909	hsa-miR-4793-3p	CLIP-seq
MIRT881902	hsa-miR-579	CLIP-seq
MIRT881913	hsa-miR-651	CLIP-seq
MIRT881903	hsa-miR-876-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
YBX1	Activation	20596676

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	8242750
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	8127873
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	12745075
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA	21873635
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	8242750
GO:0005515	Function	Protein binding	IPI	8242750, 9840943, 11463386, 15530371, 15671017, 24218572, 25852190
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0007050	Process	Cell cycle arrest	IBA	21873635
GO:0007050	Process	Cell cycle arrest	IDA	8242750
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	TAS	8242750
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8242750
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10669749
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA

MIM	HGNC	e!Ensembl
123832	1791	ENSG00000100526

Protein

UniProt ID

Q16667

Protein name

Cyclin-dependent kinase inhibitor 3 (EC 3.1.3.16) (EC 3.1.3.48) (CDK2-associated dual-specificity phosphatase) (Cyclin-dependent kinase interactor 1) (Cyclin-dependent kinase-interacting protein 2) (Kinase-associated phosphatase)

Protein function

May play a role in cell cycle regulation. Dual specificity CC phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues (PubMed:8127873, PubMed:8242750). Dephosphorylates CDK2 at 'Thr-160' in a cyclin-depen

PDB

1FPZ , 1FQ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05706	CDKN3	1 → 168	Cyclin-dependent kinase inhibitor 3 (CDKN3)	Domain

Sequence

MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR

Sequence length

212

Interactions

View interactions

Associated diseases

Show/Hide Unknown Diseases (1)

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560, 10987270

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412