AKR1A1 (aldo-keto reductase family 1 member A1)

Gene

• Entrez ID: 10327
• Gene name: Aldo-keto reductase family 1 member A1
• Gene symbol: AKR1A1
• Synonyms: ALDR1, ALR, ARM, DD3, HEL-S-6
• Chromosome: 1
• Chromosome location: 1p34.1
• Summary: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025351	hsa-miR-34a-5p	Proteomics	21566225
MIRT032282	hsa-let-7b-5p	Proteomics	18668040
MIRT045288	hsa-miR-186-5p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004032	Function	Alditol:NADP+ 1-oxidoreductase activity	IBA	21873635
GO:0004033	Function	Aldo-keto reductase (NADP) activity	TAS
GO:0004745	Function	Retinol dehydrogenase activity	ISS
GO:0005515	Function	Protein binding	IPI	21044950, 32814053
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006006	Process	Glucose metabolic process	TAS	2498333
GO:0006081	Process	Cellular aldehyde metabolic process	TAS	2498333
GO:0009055	Function	Electron transfer activity	TAS	2498333
GO:0016324	Component	Apical plasma membrane	ISS
GO:0019640	Process	Glucuronate catabolic process to xylulose 5-phosphate	TAS
GO:0019853	Process	L-ascorbic acid biosynthetic process	IEA
GO:0022900	Process	Electron transport chain	IEA
GO:0042840	Process	D-glucuronate catabolic process	IEA
GO:0044597	Process	Daunorubicin metabolic process	IDA	18276838
GO:0044598	Process	Doxorubicin metabolic process	IDA	18276838
GO:0045202	Component	Synapse	IEA
GO:0046185	Process	Aldehyde catabolic process	IEA
GO:0047655	Function	Allyl-alcohol dehydrogenase activity	IEA
GO:0047939	Function	L-glucuronate reductase activity	EXP	7669785
GO:0047939	Function	L-glucuronate reductase activity	IDA	10510318
GO:0047941	Function	Glucuronolactone reductase activity	IDA	10510318
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0110095	Process	Cellular detoxification of aldehyde	ISS
GO:1901687	Process	Glutathione derivative biosynthetic process	TAS

Other IDs

• MIM: 103830
• HGNC: 380
• e!Ensembl: ENSG00000117448

Protein

• UniProt ID: P14550
• Protein name: Aldo-keto reductase family 1 member A1 (EC 1.1.1.2) (EC 1.1.1.372) (EC 1.1.1.54) (Alcohol dehydrogenase [NADP(+)]) (Aldehyde reductase) (Glucuronate reductase) (EC 1.1.1.19) (Glucuronolactone reductase) (EC 1.1.1.20) (S-nitroso-CoA reductase) (ScorR) (EC
• Protein function: Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols (PubMed:10510318, PubMed:30538128). Displays enzymatic activity towards endogenous metabolites such as aromatic and alipha
• PDB: 2ALR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	16 → 294	Aldo/keto reductase family	Domain

• Sequence:

  MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
  KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
  GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
  AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
  YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
  PMLTVDGKRVPRDAGHPLYPFNDPY

• Sequence length: 325

Pathways

KEGG:

Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Glycerolipid metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of cofactors
Chemical carcinogenesis - reactive oxygen species

Reactome:

Glutathione conjugation
Formation of xylulose-5-phosphate

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	23468174

Unknown
Disease name	Disease term	dbSNP ID	References
Necrotizing enterocolitis	Necrotizing Enterocolitis		18806098