CDKN2D (cyclin dependent kinase inhibitor 2D)

Gene

• Entrez ID: 1032
• Gene name: Cyclin dependent kinase inhibitor 2D
• Gene symbol: CDKN2D
• Synonyms: INK4D, p19, p19-INK4D
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024530	hsa-miR-215-5p	Microarray	19074876
MIRT026171	hsa-miR-192-5p	Microarray	19074876
MIRT028887	hsa-miR-26b-5p	Microarray	19088304
MIRT043416	hsa-miR-331-3p	CLASH	23622248
MIRT733490	hsa-miR-451a	Luciferase reporter assay, Western blot	26019450
MIRT733472	hsa-miR-486-5p	RNA-seq	34199766
MIRT733490	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT733490	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT736370	hsa-miR-18a-3p	qRT-PCR	32382354
MIRT881882	hsa-miR-3689d	CLIP-seq
MIRT881883	hsa-miR-4254	CLIP-seq
MIRT881884	hsa-miR-4292	CLIP-seq
MIRT881885	hsa-miR-4308	CLIP-seq
MIRT881886	hsa-miR-617	CLIP-seq
MIRT881887	hsa-miR-645	CLIP-seq
MIRT881886	hsa-miR-617	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	8741839
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	10208428
GO:0000731	Process	DNA synthesis involved in DNA repair	IMP	15750620
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	8741839
GO:0005515	Function	Protein binding	IPI	9751050, 16189514, 21516116, 23602568, 24981860, 25416956, 25910212, 27107012, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	8741839, 15750620
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	15750620
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007050	Process	Cell cycle arrest	IDA	10208428
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10208428
GO:0009411	Process	Response to UV	IMP	15750620
GO:0019901	Function	Protein kinase binding	IPI	8741839
GO:0030308	Process	Negative regulation of cell growth	IDA	10208428
GO:0032526	Process	Response to retinoic acid	IMP	16322758
GO:0033280	Process	Response to vitamin D	IMP	16322758
GO:0042326	Process	Negative regulation of phosphorylation	IDA	10208428
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	15750620
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0048102	Process	Autophagic cell death	IMP	16322758
GO:0097129	Component	Cyclin D2-CDK4 complex	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15750620
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	TAS

Other IDs

• MIM: 600927
• HGNC: 1790
• e!Ensembl: ENSG00000129355

Protein

• UniProt ID: P55273
• Protein name: Cyclin-dependent kinase 4 inhibitor D (p19-INK4d)
• Protein function: Interacts strongly with CDK4 and CDK6 and inhibits them.
• PDB: 1BD8, 1BI8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	12 → 104	Ankyrin repeats (3 copies)	Repeat

• Sequence:

  MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
  LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
  AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

• Sequence length: 166

Pathways

KEGG:

FoxO signaling pathway
Cell cycle

Reactome:

Oxidative Stress Induced Senescence
Senescence-Associated Secretory Phenotype (SASP)
Oncogene Induced Senescence
Cyclin D associated events in G1

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923

Unknown
Disease name	Disease term	dbSNP ID	References
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		16367923