CDKN2B (cyclin dependent kinase inhibitor 2B)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
1030 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Cyclin dependent kinase inhibitor 2B |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
CDKN2B |
SynonymsGene synonyms aliases
|
CDK4I, INK4B, MTS2, P15, TP15, p15INK4b |
ChromosomeChromosome number
|
9 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
9p21.3 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the ac |
miRNAmiRNA information provided by mirtarbase database.
|
|
Transcription factors
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
GO ID |
Ontology |
Definition |
Evidence |
Reference |
GO:0000079 |
Process |
Regulation of cyclin-dependent protein serine/threonine kinase activity |
IDA |
8078588 |
GO:0000086 |
Process |
G2/M transition of mitotic cell cycle |
IMP |
17553787 |
GO:0004861 |
Function |
Cyclin-dependent protein serine/threonine kinase inhibitor activity |
IDA |
8078588 |
GO:0004861 |
Function |
Cyclin-dependent protein serine/threonine kinase inhibitor activity |
NAS |
9230210 |
GO:0005515 |
Function |
Protein binding |
IPI |
16169070, 16189514, 19447967, 21900206, 23455922, 23602568, 24981860, 25416956, 25910212, 26496610, 28514442, 31515488, 32296183 |
GO:0005634 |
Component |
Nucleus |
IDA |
9230210, 18564286 |
GO:0005737 |
Component |
Cytoplasm |
IDA |
9230210, 16943770 |
GO:0005829 |
Component |
Cytosol |
TAS |
|
GO:0007050 |
Process |
Cell cycle arrest |
IMP |
17553787 |
GO:0008285 |
Process |
Negative regulation of cell population proliferation |
IMP |
17553787 |
GO:0019901 |
Function |
Protein kinase binding |
IPI |
8078588 |
GO:0030219 |
Process |
Megakaryocyte differentiation |
IEP |
10812241 |
GO:0030511 |
Process |
Positive regulation of transforming growth factor beta receptor signaling pathway |
IMP |
16943770 |
GO:0031668 |
Process |
Cellular response to extracellular stimulus |
IMP |
17553787 |
GO:0031670 |
Process |
Cellular response to nutrient |
IMP |
17597576 |
GO:0042326 |
Process |
Negative regulation of phosphorylation |
IDA |
8078588 |
GO:0045736 |
Process |
Negative regulation of cyclin-dependent protein serine/threonine kinase activity |
IEA |
|
GO:0045944 |
Process |
Positive regulation of transcription by RNA polymerase II |
TAS |
|
GO:0048536 |
Process |
Spleen development |
IEA |
|
GO:0050680 |
Process |
Negative regulation of epithelial cell proliferation |
IMP |
16943770 |
GO:0070316 |
Process |
Regulation of G0 to G1 transition |
IMP |
17553787 |
GO:0090398 |
Process |
Cellular senescence |
IMP |
17553787 |
GO:2000134 |
Process |
Negative regulation of G1/S transition of mitotic cell cycle |
TAS |
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P42772 |
Protein name |
Cyclin-dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B) |
Protein function |
Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest. |
Family and domains |
|
Sequence |
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA EERGHRDVAGYLRTATGD
|
|
Sequence length |
138 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Adrenocortical adenoma |
Adrenal Cortical Adenoma |
rs121913035 |
|
Adrenocortical carcinoma |
Adrenocortical carcinoma |
rs121912656, rs28934874, rs121912662, rs786202525, rs121912664, rs397516435, rs121913343, rs587780070, rs121912666, rs55832599, rs587782144, rs587782272, rs587782529, rs587782620, rs587782664, rs587782705, rs193920817, rs55863639, rs730882029, rs730882005, rs730882025, rs730881999, rs786201838, rs786202962, rs863224451, rs863224499, rs760043106, rs11540652, rs11540654, rs876658483, rs587781525, rs1057519986, rs1057519989, rs530941076, rs1060501197, rs1064792930, rs1064794618, rs1131691042, rs1555526131, rs1057519990, rs1555526097, rs1567554500, rs1131691039, rs1202793339, rs769697802 |
|
Angiofibroma |
Angiofibroma |
rs121913034, rs267607234 |
|
Cholestasis |
Cholestasis, Extrahepatic |
rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039 |
|
Hyperinsulinemic hypoglycemia |
Congenital Hyperinsulinism, Hyperinsulinemic hypoglycemia |
rs137853103, rs2126234459, rs104894237, rs267607196, rs387906407, rs151344623, rs28936370, rs28938469, rs28936371, rs137852671, rs137852672, rs72559723, rs193922400, rs137852676, rs193922402, rs980458021, rs375717077, rs786200932, rs587783169, rs72559713, rs72559716, rs786204542, rs541269678, rs570388861, rs72559722, rs786204676, rs151344624, rs797045637, rs797045212, rs797045211, rs797045207, rs797045213, rs761749884, rs863225280, rs139964066, rs886039877, rs886041392, rs886041391, rs746480424, rs1057516281, rs1057516317, rs576684889, rs764613146, rs773306994, rs1057516946, rs1057517139, rs1057516591, rs201682634, rs766891274, rs193922405, rs72559715, rs769518471, rs757171524, rs139328569, rs768951263, rs72559718, rs1260178539, rs200670692, rs72559734, rs1554910610, rs1554924035, rs372307320, rs1446306735, rs925231098, rs1554913069, rs1554923999, rs765090096, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1554949176, rs1411638309, rs1008906426, rs758844607, rs1554924540, rs755259997, rs769569410, rs72559730, rs367850779, rs1382448285, rs1564977373, rs750586210, rs1398546361, rs781617345 |
|
Coronary artery disease |
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1, Coronary Artery Disease |
rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537 |
23202125, 24262325, 29212778, 23104008 |
Diabetes mellitus |
Diabetes Mellitus, Non-Insulin-Dependent |
rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261 |
30054458 |
Glaucoma |
Glaucoma, Glaucoma, Open-Angle |
rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328, rs121909193, rs74315330, rs74315329, rs74315332, rs74315334, rs74315336, rs74315338, rs74315341, rs121909194, rs74315331, rs1558603396, rs387907175, rs587778873, rs587778875, rs104894979, rs137854895, rs766425037, rs72549380, rs148542782, rs541217363, rs753021890, rs771076928, rs56010818, rs777678299, rs1446110883, rs1573274915, rs1587545234, rs751768343, rs944452644 |
21532571, 22792221, 22570617, 22419738 |
Glioma |
Glioma, mixed gliomas, Malignant Glioma |
rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499, rs1060500122, rs781647403, rs1060500126, rs1554897889, rs1114167629, rs1114167656, rs587782603, rs1554893824, rs1554900615, rs1564568660, rs786204900, rs762518389, rs1339631701 |
19578367, 19578366, 21531791, 19578366, 19578367 |
Hypercalcemia |
Hypercalcemia |
rs876657376, rs387907322, rs777676129, rs387907323, rs114368325, rs6068812, rs387907324, rs777947329, rs201304511, rs769409705, rs200095793, rs876661338, rs1554095500, rs139763321, rs774432244, rs781367354 |
|
Hyperparathyroidism |
Hyperparathyroidism |
rs28942098, rs121434262, rs80356649, rs121434264, rs587776558, rs587776559, rs121909259, rs104893689, rs28936684, rs104893690, rs869320729, rs104893700, rs104893705, rs104893707, rs104893709, rs863223311, rs80356650, rs193922432, rs886041637, rs201633414, rs1057519419, rs766719790, rs1281361203, rs759393722, rs1342435095, rs1200458339, rs755916513, rs1586190048, rs1558280170 |
|
Lung adenocarcinoma |
Adenocarcinoma of lung (disorder) |
rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370, rs760043106, rs1057519788, rs1131692238, rs1131692237, rs1554350382 |
|
Lymphoma |
Lymphoma |
rs11540652, rs1592119138, rs1592123162, rs1599367044 |
9488045 |
Lymphoblastic leukemia |
Precursor Cell Lymphoblastic Leukemia Lymphoma |
rs387906351, rs104894562, rs398122513, rs398122840, rs398123063, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699, rs1597567692, rs1597567985, rs1438890364, rs1288977950, rs1597552140, rs1597566356, rs1597566726, rs1597568117, rs2069719445, rs2069729948, rs2070018439, rs745708044, rs1169577591 |
29348612 |
Melanoma |
melanoma, Familial melanoma |
rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050 |
|
Multiple endocrine neoplasia |
Multiple Endocrine Neoplasia Type 1 |
rs121917832, rs76262710, rs75076352, rs75996173, rs80069458, rs79781594, rs77316810, rs77503355, rs77709286, rs74799832, rs76764689, rs76449634, rs78014899, rs77939446, rs79890926, rs75030001, rs77558292, rs79658334, rs75873440, rs75234356, rs104894256, rs397515385, rs104894258, rs1555164986, rs869025185, rs104894259, rs104894260, rs104894261, rs28931612, rs104894266, rs104894267, rs587776841, rs104894262, rs104894263, rs1941851693, rs104894264, rs104894265, rs863223311, rs760199250, rs1060499976, rs377767396, rs377767391, rs377767397, rs377767404, rs377767405, rs377767406, rs377767412, rs143795581, rs146646971, rs377767440, rs386134245, rs386134246, rs386134247, rs386134249, rs386134250, rs386134251, rs386134253, rs386134254, rs386134255, rs386134256, rs386134258, rs386134259, rs386134260, rs386134261, rs377767442, rs377767398, rs377767429, rs794728622, rs398124435, rs398124437, rs730882136, rs786201007, rs786201010, rs786201011, rs786204242, rs794728631, rs794728630, rs761695866, rs767319284, rs794728659, rs794728629, rs764570645, rs794728654, rs794728625, rs794728624, rs794728621, rs794728640, rs104894257, rs794728650, rs376872829, rs794728657, rs794728647, rs794728639, rs794728616, rs794728615, rs794728614, rs863224527, rs863224526, rs864622617, rs864622615, rs878855198, rs878855196, rs878855192, rs878855191, rs886039421, rs886039419, rs886039418, rs886039416, rs886039415, rs886039414, rs886039553, rs886039413, rs886041213, rs886041214, rs886042035, rs1057517902, rs1057518572, rs1057521110, rs1057521111, rs794728648, rs1057520733, rs1060500759, rs1060499974, rs750904332, rs1060499973, rs778670301, rs1060499991, rs1060499986, rs1060499992, rs1555166494, rs1555163780, rs1060499981, rs2071312, rs1555166609, rs772588551, rs1060500186, rs1060499987, rs1060499990, rs1555163591, rs1060503789, rs1064793167, rs1064793672, rs1064793613, rs1555166711, rs1085307471, rs1114167510, rs1114167514, rs1114167536, rs1114167531, rs1114167528, rs1114167542, rs1114167524, rs1114167513, rs1060499984, rs767078097, rs1114167489, rs1114167482, rs1114167483, rs1114167508, rs1114167469, rs1114167498, rs794728652, rs1114167499, rs1114167519, rs1114167538, rs1114167515, rs1114167486, rs1114167491, rs1555166695, rs1114167523, rs1555165128, rs1555166387, rs1555165488, rs972128957, rs1555165377, rs1555164270, rs1555165503, rs778921501, rs1555165756, rs141679530, rs1555163883, rs1555164115, rs1555165809, rs1555166466, rs532903617, rs1555085549, rs1555166368, rs1555164430, rs1555165485, rs1555166567, rs1555163646, rs776561706, rs1555166681, rs1555085575, rs1555165360, rs1555166365, rs1555164707, rs1555164946, rs1555164184, rs1565634591, rs1565640081, rs1565635941, rs1565642765, rs1565647767, rs1565648547, rs1565648789, rs1565651223, rs1565651568, rs1565645563, rs1565647197, rs1565648656, rs794728627, rs1564500612, rs1565644366, rs1565646772, rs1349668409, rs1588862638, rs1483605155, rs1592630079, rs1592633378, rs1592633463, rs1592637081, rs1592637440, rs1592637455, rs1187634059, rs1592647398, rs1592648765, rs1592648830, rs1592649108, rs1592651767, rs1592657785, rs1592660101, rs1565652689, rs1592280948, rs1592280992, rs1592634740, rs1592649598, rs1592649615, rs1588873476, rs1592280833, rs1592658517, rs1592640181, rs1397494237, rs1592631908, rs1592636161, rs1592643178, rs1592649069, rs1592281087, rs755301027, rs1941501683, rs1941615895, rs1941625647, rs1941850919, rs1941861451, rs1941994887, rs1946487230, rs1946491613, rs1946492962, rs1941733228, rs1941598294, rs1064793168 |
19141585 |
Myelodysplastic syndrome |
MYELODYSPLASTIC SYNDROME |
rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587 |
17294728 |
Parathyroid adenoma |
Parathyroid Adenoma |
rs587776557 |
|
Pituitary adenoma |
Pituitary growth hormone cell adenoma, ACTH-Secreting Pituitary Adenoma, Non-Functioning Pituitary Gland Neoplasm |
rs5030861, rs104894194, rs121908356, rs121908347, rs727502931, rs121908348, rs121908349, rs111033271, rs121908351, rs121917839, rs121917840, rs587776681, rs193922688, rs121917841, rs587776682, rs587776683, rs121917842, rs121917843, rs121917844, rs121917845, rs11554273, rs121913495, rs121913494, rs137854533, rs140016178, rs397517323, rs397517327, rs397517329, rs397517341, rs397517342, rs183431253, rs397517350, rs370983472, rs397517367, rs794726693, rs727502919, rs766673446, rs786204663, rs1556379508, rs876657754, rs773464867, rs878853337, rs886037871, rs762529663, rs1057517027, rs1057517041, rs1057516832, rs1057517424, rs1057516846, rs1057524265, rs1060499789, rs750803248, rs1064797071, rs756147087, rs758382198, rs750880909, rs1554877806, rs769433759, rs1474524543, rs866435331, rs936479651, rs146918863, rs1554182514, rs1436089021, rs1554182507, rs1554182481, rs1554182645, rs1554182405, rs1554182632, rs747955135, rs745571683, rs1190307769, rs1564808024, rs1214465435, rs1589424694, rs1200012430, rs1377982927, rs1230303971, rs750027965, rs1292050472, rs1278603247, rs1862873659, rs1338446830, rs771766431, rs759981467, rs780917129, rs1221464948, rs1166948274, rs754876029, rs762805265 |
|
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Atypical mole melanoma syndrome |
Familial Atypical Mole Melanoma Syndrome |
|
|
Mammary neoplasms |
Mammary Neoplasms |
|
|
Coronary arteriosclerosis |
Coronary Arteriosclerosis |
|
23104008 |
Eosinophilia |
Esophagitis |
|
|
Glucagonoma |
Glucagonoma |
|
|
Insulinoma |
insulinoma |
|
|
Malignant neoplasm |
Malignant Neoplasms |
|
|
Nasopharyngeal neoplasms |
Nasopharyngeal Neoplasms |
|
26545403 |
Nevus |
Nevus |
|
|
Pancreatic neoplasm |
Pancreatic Neoplasm |
|
|
Parathyroid hyperplasia |
Parathyroid hyperplasia |
|
|
Peptic ulcer |
Peptic Ulcer |
|
|
Prolactinoma |
Prolactinoma |
|
|
Retinal diseases |
Retinal Diseases |
|
|
Stomach neoplasms |
Stomach Neoplasms |
|
|
Subcutaneous lipoma |
Subcutaneous lipoma |
|
|
Thymoma |
Thymoma |
|
|
Thyroid gland follicular adenoma |
Thyroid Gland Follicular Adenoma |
|
|
Zollinger-ellison syndrome |
Zollinger-Ellison syndrome |
|
|
|
|
|