KCNMB2 (potassium calcium-activated channel subfamily M regulatory beta subunit 2)

Gene

• Entrez ID: 10242
• Gene name: Potassium calcium-activated channel subfamily M regulatory beta subunit 2
• Gene symbol: KCNMB2
• Synonyms: -
• Chromosome: 3
• Chromosome location: 3q26.32
• Summary: MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT734908	hsa-miR-3194-3p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization, Flow cytometry	34026626
MIRT1082087	hsa-miR-1276	CLIP-seq
MIRT1082088	hsa-miR-3942-5p	CLIP-seq
MIRT1082089	hsa-miR-4703-5p	CLIP-seq
MIRT1082090	hsa-miR-4719	CLIP-seq
MIRT1082091	hsa-miR-513b	CLIP-seq
MIRT2020422	hsa-miR-4778-3p	CLIP-seq
MIRT2252179	hsa-miR-181a	CLIP-seq
MIRT2252180	hsa-miR-181b	CLIP-seq
MIRT2252181	hsa-miR-181c	CLIP-seq
MIRT2252182	hsa-miR-181d	CLIP-seq
MIRT2252183	hsa-miR-4262	CLIP-seq
MIRT2252184	hsa-miR-513a-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IDA	10692449
GO:0005513	Process	Detection of calcium ion	IBA	21873635
GO:0005513	Process	Detection of calcium ion	IDA	10692449
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	10692449
GO:0006813	Process	Potassium ion transport	IDA	10692449
GO:0008076	Component	Voltage-gated potassium channel complex	IBA	21873635
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	10692449
GO:0008200	Function	Ion channel inhibitor activity	TAS	10097176
GO:0015269	Function	Calcium-activated potassium channel activity	IBA	21873635
GO:0015269	Function	Calcium-activated potassium channel activity	IDA	10692449
GO:0015459	Function	Potassium channel regulator activity	IBA	21873635
GO:0019228	Process	Neuronal action potential	IDA	10692449
GO:0019229	Process	Regulation of vasoconstriction	TAS	10692449
GO:0071805	Process	Potassium ion transmembrane transport	IEA

Other IDs

• MIM: 605214
• HGNC: 6286
• e!Ensembl: ENSG00000197584

Protein

• UniProt ID: Q9Y691
• Protein name: Calcium-activated potassium channel subunit beta-2 (BK channel subunit beta-2) (BKbeta2) (Hbeta2) (Calcium-activated potassium channel, subfamily M subunit beta-2) (Charybdotoxin receptor subunit beta-2) (Hbeta3) (K(VCA)beta-2) (Maxi K channel subunit bet
• Protein function: Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and
• PDB: 1JO6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09303	KcnmB2_inactiv	1 → 32	KCNMB2, ball and chain domain	Domain
  PF03185	CaKB	38 → 229	Calcium-activated potassium channel, beta subunit	Family

• Sequence:

  MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
  MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
  TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
  NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR

• Sequence length: 235

Pathways

KEGG:

cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion

Reactome:

Ca2+ activated K+ channels

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Amyotrophic lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder), AMYOTROPHIC LATERAL SCLEROSIS 1, AUTOSOMAL RECESSIVE	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733, rs80356731, rs80356726, rs267606928, rs267606929, rs1885090126, rs121434591, rs121912431, rs121912432, rs121912433, rs121912434, rs121912435, rs121912440, rs121912436, rs121912437, rs121912438, rs121912439, rs74315452, rs121912442, rs121912443, rs121912444, rs121912446, rs121912447, rs1197141604, rs121912448, rs121912449, rs121912450, rs121912451, rs121912452, rs121912453, rs121912454, rs369600566, rs121912455, rs121912456, rs121912457, rs121912458, rs1555836889, rs121909667, rs121909668, rs121909669, rs121909671, rs121909535, rs121909537, rs121909538, rs121909539, rs121909540, rs121909542, rs121909544, rs80356734, rs367543041, rs80356740, rs80356719, rs80356721, rs80356723, rs80356725, rs387906627, rs387906628, rs387906709, rs387906710, rs387906711, rs387906829, rs387907264, rs387907265, rs387907266, rs312262739, rs312262709, rs312262749, rs200793464, rs147713329, rs312262788, rs397514262, rs63751180, rs587777132, rs730880025, rs730880026, rs730880027, rs368743618, rs730880029, rs730882255, rs730882256, rs786205611, rs121912441, rs199947197, rs780136067, rs772731615, rs879253926, rs879254294, rs764717219, rs886041390, rs750159428, rs753207473, rs267607087, rs767350733, rs778305085, rs1554707680, rs1554707622, rs1393363759, rs750959420, rs1555509569, rs1554716504, rs11556620, rs1247392012, rs142083484, rs140385286, rs749428135, rs371575563, rs1402429085, rs1218712729, rs1555179091, rs1555179087, rs746971952, rs1555836950, rs368276916, rs140376902, rs747220413, rs76731700, rs770684782, rs1200906022, rs1804449, rs1482760341, rs769898852, rs140599944, rs757972700, rs1555451521, rs1592362719, rs1555836803, rs763455928, rs1378590183, rs1583695322, rs1362178149, rs1197928094, rs368751524, rs1555509609, rs1574787779, rs1601157750, rs1301635320, rs1341055534, rs1402092579, rs1568809172, rs1555836170, rs1315541036, rs1339283341, rs1643659556, rs1644506661, rs1435710212, rs1553122918, rs1689580631, rs374047961, rs775935265, rs2076486420, rs1820836522, rs757260058, rs1844420892, rs1833371664, rs1833438306, rs1833451208, rs2083790483, rs1303294230, rs1226110412, rs2053207945, rs2053208751, rs2053501632, rs2053539304, rs1567479067, rs544088874, rs1228194239, rs1568807400, rs1169198442, rs2049594204, rs2049594311, rs1568810641, rs1568811372, rs2049618449, rs1476760624, rs2079347087	24529757
Lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic	rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048	24529757
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	22688191

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder		22688191
Mental disorders	Mental disorders		22688191
Mental depression	Major Depressive Disorder	rs587778876, rs587778877	29317602
Psychosis	Psychotic Disorders		22688191