OLIG2 (oligodendrocyte transcription factor 2)

Gene

• Entrez ID: 10215
• Gene name: Oligodendrocyte transcription factor 2
• Gene symbol: OLIG2
• Synonyms: BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19
• Chromosome: 21
• Chromosome location: 21q22.11
• Summary: This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal transl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024220	hsa-miR-218-5p	Sequencing	20371350
MIRT1203299	hsa-miR-1179	CLIP-seq
MIRT1203300	hsa-miR-140-5p	CLIP-seq
MIRT1203301	hsa-miR-2115	CLIP-seq
MIRT1203302	hsa-miR-3125	CLIP-seq
MIRT1203303	hsa-miR-3202	CLIP-seq
MIRT1203304	hsa-miR-3689d	CLIP-seq
MIRT1203305	hsa-miR-383	CLIP-seq
MIRT1203306	hsa-miR-3916	CLIP-seq
MIRT1203307	hsa-miR-4257	CLIP-seq
MIRT1203308	hsa-miR-4446-5p	CLIP-seq
MIRT1203309	hsa-miR-4474-3p	CLIP-seq
MIRT1203310	hsa-miR-4476	CLIP-seq
MIRT1203311	hsa-miR-4637	CLIP-seq
MIRT1203312	hsa-miR-4694-5p	CLIP-seq
MIRT1203313	hsa-miR-609	CLIP-seq
MIRT2058705	hsa-miR-1252	CLIP-seq
MIRT2058706	hsa-miR-3925-5p	CLIP-seq
MIRT2286885	hsa-miR-1539	CLIP-seq
MIRT2286886	hsa-miR-3193	CLIP-seq
MIRT2286887	hsa-miR-4667-3p	CLIP-seq
MIRT2286888	hsa-miR-4749-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0021522	Process	Spinal cord motor neuron differentiation	IEA
GO:0021530	Process	Spinal cord oligodendrocyte cell fate specification	IEA
GO:0021794	Process	Thalamus development	IEA
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0071837	Function	HMG box domain binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 606386
• HGNC: 9398
• e!Ensembl: ENSG00000205927

Protein

• UniProt ID: Q13516
• Protein name: Oligodendrocyte transcription factor 2 (Oligo2) (Class B basic helix-loop-helix protein 1) (bHLHb1) (Class E basic helix-loop-helix protein 19) (bHLHe19) (Protein kinase C-binding protein 2) (Protein kinase C-binding protein RACK17)
• Protein function: Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Functions together with ZNF488 to promote oligodendrocyte differentiation. Cooperates with
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	109 → 163	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
  SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
  MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
  HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
  ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
  PPPHHHVSAMGAGSLPRLTSDAK

• Sequence length: 323

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	17964117, 18996920, 19477230, 17934761, 17010574

Unknown
Disease name	Disease term	dbSNP ID	References
Nonorganic psychosis	Nonorganic psychosis		19477230
Psychosis	Psychotic Disorders		19477230