FLOT1 (flotillin 1)

Gene

• Entrez ID: 10211
• Gene name: Flotillin 1
• Gene symbol: FLOT1
• Synonyms: -
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes an protein that localizes to the caveolae, which are small domains on the inner cell membranes. This protein plays a role in vesicle trafficking and cell morphology. Alternative splicing results in multiple transcript variants. [provided

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024958	hsa-miR-214-3p	Microarray;Other	19859982
MIRT047187	hsa-miR-182-5p	CLASH	23622248
MIRT044822	hsa-miR-320a	CLASH	23622248
MIRT041850	hsa-miR-484	CLASH	23622248
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT438215	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24330780
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504107	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT731296	hsa-miR-485-5p	Luciferase reporter assay, Western blot	26807169
MIRT731296	hsa-miR-485-5p	Luciferase reporter assay, qRT-PCR, Western blot	26807169
MIRT731296	hsa-miR-485-5p	Luciferase reporter assay, qRT-PCR, Western blot	26807169
MIRT438215	hsa-miR-124-3p	Western blot	26002553
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT504110	hsa-miR-4640-3p	PAR-CLIP	23446348
MIRT504109	hsa-miR-3127-3p	PAR-CLIP	23446348
MIRT504108	hsa-miR-6756-3p	PAR-CLIP	23446348
MIRT504107	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504106	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT504105	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998854	hsa-miR-1225-5p	CLIP-seq
MIRT998855	hsa-miR-124	CLIP-seq
MIRT998856	hsa-miR-1271	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998858	hsa-miR-132	CLIP-seq
MIRT998859	hsa-miR-143	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998861	hsa-miR-185	CLIP-seq
MIRT998862	hsa-miR-212	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998864	hsa-miR-3132	CLIP-seq
MIRT998865	hsa-miR-3135b	CLIP-seq
MIRT998866	hsa-miR-3184	CLIP-seq
MIRT998867	hsa-miR-3649	CLIP-seq
MIRT998868	hsa-miR-3920	CLIP-seq
MIRT998869	hsa-miR-423-5p	CLIP-seq
MIRT998870	hsa-miR-4274	CLIP-seq
MIRT998871	hsa-miR-4302	CLIP-seq
MIRT998872	hsa-miR-4306	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998874	hsa-miR-4428	CLIP-seq
MIRT998875	hsa-miR-4476	CLIP-seq
MIRT998876	hsa-miR-4519	CLIP-seq
MIRT998877	hsa-miR-4644	CLIP-seq
MIRT998878	hsa-miR-4651	CLIP-seq
MIRT998879	hsa-miR-4653-3p	CLIP-seq
MIRT998880	hsa-miR-4666-5p	CLIP-seq
MIRT998881	hsa-miR-4715-5p	CLIP-seq
MIRT998882	hsa-miR-4770	CLIP-seq
MIRT998883	hsa-miR-506	CLIP-seq
MIRT998884	hsa-miR-548p	CLIP-seq
MIRT998885	hsa-miR-570	CLIP-seq
MIRT998886	hsa-miR-571	CLIP-seq
MIRT998887	hsa-miR-608	CLIP-seq
MIRT998888	hsa-miR-622	CLIP-seq
MIRT998889	hsa-miR-939	CLIP-seq
MIRT998890	hsa-miR-96	CLIP-seq
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998855	hsa-miR-124	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998859	hsa-miR-143	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998861	hsa-miR-185	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998866	hsa-miR-3184	CLIP-seq
MIRT998867	hsa-miR-3649	CLIP-seq
MIRT998869	hsa-miR-423-5p	CLIP-seq
MIRT998870	hsa-miR-4274	CLIP-seq
MIRT998871	hsa-miR-4302	CLIP-seq
MIRT998872	hsa-miR-4306	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998874	hsa-miR-4428	CLIP-seq
MIRT998876	hsa-miR-4519	CLIP-seq
MIRT998877	hsa-miR-4644	CLIP-seq
MIRT1995993	hsa-miR-4648	CLIP-seq
MIRT998878	hsa-miR-4651	CLIP-seq
MIRT998882	hsa-miR-4770	CLIP-seq
MIRT998883	hsa-miR-506	CLIP-seq
MIRT998887	hsa-miR-608	CLIP-seq
MIRT998889	hsa-miR-939	CLIP-seq
MIRT998853	hsa-miR-103b	CLIP-seq
MIRT998857	hsa-miR-1294	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq
MIRT998863	hsa-miR-31	CLIP-seq
MIRT998873	hsa-miR-4316	CLIP-seq
MIRT998860	hsa-miR-182	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001765	Process	Membrane raft assembly	IMP	25204797
GO:0001819	Process	Positive regulation of cytokine production	IMP	25204797
GO:0001931	Component	Uropod	IDA	21696602
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	25204797
GO:0002020	Function	Protease binding	IPI	24612608
GO:0002090	Process	Regulation of receptor internalization	IBA	21873635
GO:0002090	Process	Regulation of receptor internalization	IMP	21399631
GO:0005515	Function	Protein binding	IPI	15469992, 16480949, 17113085, 21119006, 21696602, 24167781, 24809731, 25959826, 30021884, 30614533, 32296183, 32814053
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005768	Component	Endosome	IDA	20682791
GO:0005769	Component	Early endosome	IDA	21399631
GO:0005815	Component	Microtubule organizing center	IDA	18000879
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	21399631
GO:0005886	Component	Plasma membrane	IMP	21696602
GO:0005886	Component	Plasma membrane	TAS	9153235
GO:0005901	Component	Caveola	TAS	9153235
GO:0005911	Component	Cell-cell junction	IDA	25468996
GO:0005912	Component	Adherens junction	IDA	24046456
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007409	Process	Axonogenesis	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016323	Component	Basolateral plasma membrane	IDA	23983584
GO:0016324	Component	Apical plasma membrane	IDA	23983584
GO:0016600	Component	Flotillin complex	IBA	21873635
GO:0016600	Component	Flotillin complex	IDA	21399631, 21696602, 24046456, 25204797
GO:0022617	Process	Extracellular matrix disassembly	IMP	21119006
GO:0030027	Component	Lamellipodium	IDA	24046456
GO:0030864	Component	Cortical actin cytoskeleton	IDA	24046456
GO:0031410	Component	Cytoplasmic vesicle	IBA	21873635
GO:0031410	Component	Cytoplasmic vesicle	IDA	23983584
GO:0032092	Process	Positive regulation of protein binding	IMP	24046456
GO:0032226	Process	Positive regulation of synaptic transmission, dopaminergic	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	25204797
GO:0033227	Process	DsRNA transport	IMP	25204797
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IMP	25204797
GO:0034141	Process	Positive regulation of toll-like receptor 3 signaling pathway	IMP	25204797
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IMP	25204797
GO:0034451	Component	Centriolar satellite	IDA	18000879
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	25204797
GO:0035023	Process	Regulation of Rho protein signal transduction	IEA
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0044291	Component	Cell-cell contact zone	IDA	23983584
GO:0044854	Process	Plasma membrane raft assembly	IMP	21399631
GO:0045121	Component	Membrane raft	IDA	15469992, 25893292
GO:0045807	Process	Positive regulation of endocytosis	IBA	21873635
GO:0045807	Process	Positive regulation of endocytosis	IMP	21399631
GO:0048643	Process	Positive regulation of skeletal muscle tissue development	IMP	24046456
GO:0048786	Component	Presynaptic active zone	IEA
GO:0050821	Process	Protein stabilization	IMP	25204797
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	23319823
GO:0051580	Process	Regulation of neurotransmitter uptake	IDA	21399631
GO:0051580	Process	Regulation of neurotransmitter uptake	IMP	21399631
GO:0060355	Process	Positive regulation of cell adhesion molecule production	IMP	25204797
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070528	Process	Protein kinase C signaling	IBA	21873635
GO:0070528	Process	Protein kinase C signaling	IMP	21399631
GO:0071360	Process	Cellular response to exogenous dsRNA	IMP	25204797
GO:0072659	Process	Protein localization to plasma membrane	IBA	21873635
GO:0072659	Process	Protein localization to plasma membrane	IMP	24046456, 24612608
GO:0098691	Component	Dopaminergic synapse	IDA	21399631
GO:0098691	Component	Dopaminergic synapse	IMP	21399631
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IMP	24046456
GO:1901890	Process	Positive regulation of cell junction assembly	IBA	21873635
GO:1901890	Process	Positive regulation of cell junction assembly	IMP	24046456
GO:1903044	Process	Protein localization to membrane raft	IMP	25204797
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IBA	21873635
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IMP	24046456

Other IDs

• MIM: 606998
• HGNC: 3757
• e!Ensembl: ENSG00000137312

Protein

• UniProt ID: O75955
• Protein name: Flotillin-1
• Protein function: May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles.
• PDB: 9BQ2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01145	Band_7	3 → 185	SPFH domain / Band 7 family	Family

• Sequence:

  MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
  VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEI
  YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
  AEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQL
  QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
  EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEK
  LPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN
  HKPLRTA

• Sequence length: 427

Pathways

KEGG:

Insulin signaling pathway

Reactome:

Synaptic adhesion-like molecules

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	17632545
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	22899653
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	21926974, 30285260

Unknown
Disease name	Disease term	dbSNP ID	References
Q fever	Chronic Q Fever		16469060