GediPNet logo

SLC25A13 (solute carrier family 25 member 13)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10165
Gene nameGene Name - the full gene name approved by the HGNC.
Solute carrier family 25 member 13
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SLC25A13
SynonymsGene synonyms aliases
ARALAR2, CITRIN, CTLN2, NICCD
ChromosomeChromosome number
7
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene is a member of the mitochondrial carrier family. The encoded protein contains four EF-hand Ca(2+) binding motifs in the N-terminal domain, and localizes to mitochondria. The protein catalyzes the exchange of aspartate for glutamate and a proton
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs80338715 C>T Pathogenic Synonymous variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant, 5 prime UTR variant
rs80338716 G>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant, 5 prime UTR variant
rs80338717 C>T Pathogenic, likely-pathogenic Intron variant
rs80338718 C>G Pathogenic Splice donor variant
rs80338719 G>A,T Pathogenic Missense variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant, stop gained
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001594 hsa-let-7b-5p pSILAC 18668040
MIRT027664 hsa-miR-98-5p Microarray 19088304
MIRT001594 hsa-let-7b-5p Proteomics;Other 18668040
MIRT001594 hsa-let-7b-5p CLASH 23622248
MIRT047732 hsa-miR-10a-5p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005313 Function L-glutamate transmembrane transporter activity IBA 21873635
GO:0005313 Function L-glutamate transmembrane transporter activity IDA 11566871
GO:0005509 Function Calcium ion binding IDA 10642534, 25410934
GO:0005739 Component Mitochondrion IDA 10642534, 11566871
GO:0005743 Component Mitochondrial inner membrane ISS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9UJS0
Protein name Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial (Calcium-binding mitochondrial carrier protein Aralar2) (ARALAR-related gene 2) (ARALAR2) (Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13)
Protein function Mitochondrial electrogenic aspartate/glutamate antiporter that favors efflux of aspartate and entry of glutamate and proton within the mitochondria as part of the malate-aspartate shuttle (PubMed:11566871, PubMed:38945283). Also mediates the upt
PDB 4P5W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00153 Mito_carr
325 423
Mitochondrial carrier protein
Family
PF00153 Mito_carr
424 515
Mitochondrial carrier protein
Family
PF00153 Mito_carr
516 611
Mitochondrial carrier protein
Family
Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKD
GSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF
GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANED
GQVSPGSLLLAGAIAGMPAASLVTP
ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY
ELLQRWFYIDF
GGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL
FKPSVSTSKAIGGGP
Sequence length 675
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Gluconeogenesis
Aspartate and asparagine metabolism
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322, rs121917775, rs121917735, rs121917736, rs137853199, rs137853200, rs121917867, rs121917869, rs121913555, rs104893736, rs121909595, rs121909596, rs121909597, rs28931605, rs121909598, rs104893618, rs1695062782, rs74315486, rs74315487, rs74315490, rs74315489, rs745938679, rs1566402656, rs74315439, rs74315441, rs121912973, rs121917823, rs1593332981, rs121917825, rs121917827, rs113994108, rs387906963, rs387906964, rs1240503246, rs387906965, rs387906966, rs750207077, rs387907336, rs387907337, rs387907342, rs140332366, rs397514703, rs398122937, rs398122378, rs398122392, rs398122944, rs137853924, rs398122947, rs397515623, rs397515624, rs397515625, rs397515626, rs398122948, rs587778872, rs398123066, rs587777601, rs370424081, rs786205221, rs786205222, rs864309684, rs864309688, rs864309701, rs864309689, rs864309690, rs864309681, rs864309686, rs864309696, rs864309693, rs864309687, rs864309691, rs864309692, rs864309695, rs864309678, rs864309685, rs864309700, rs864309698, rs864309683, rs864309682, rs864309679, rs111534978, rs864309680, rs864309702, rs864622780, rs756898971, rs869312732, rs775038545, rs878852983, rs1114167312, rs1114167313, rs1114167314, rs1114167315, rs1114167307, rs886041410, rs886041412, rs1057518738, rs1057517926, rs1057518878, rs1057519616, rs12799308, rs1064793935, rs1064797219, rs1085307126, rs1085307127, rs765628635, rs1114167427, rs1114167433, rs1554744860, rs1554743428, rs747093432, rs1411557416, rs1555179713, rs1481963503, rs1555549755, rs1456161420, rs1555547008, rs1555889308, rs1555888762, rs766522434, rs1264025914, rs1553585262, rs1567671947, rs1337897299, rs764945940, rs1307969607, rs949335475, rs1184095219, rs776129797, rs1569203234, rs1567668570, rs749141857, rs764098604, rs1184398243, rs1578956689, rs1568480054, rs1564745688, rs1564722302, rs1564723150, rs1571175950, rs1569602837, rs1576552712, rs1575369255, rs981126461, rs1570403798, rs200557771, rs1477743112, rs1651879427, rs1651881222, rs1651919374, rs2024441691, rs148284531, rs1246080692
Citrin deficiency Citrin deficiency rs80338722, rs80338725, rs80338719, rs80338723, rs80338726, rs80338721, rs80338724, rs80338715, rs80338727, rs80338729, rs80338716, rs80338717, rs398122839, rs80338720, rs746155190, rs763191789, rs758827458, rs1554335461, rs1562831765, rs962082210, rs1261058897, rs1178306013, rs764401478, rs761370420, rs768922690, rs1004549438, rs1312396424, rs1482630982, rs1792048079, rs1796684525 24586645, 10369257, 12512993, 27577219, 21507300, 27405544, 23022256, 22710133, 14680984, 19036621, 21134364
Citrullinemia CITRULLINEMIA, TYPE II, NEONATAL-ONSET, Adult-onset citrullinemia type 2, Citrullinemia type II rs80338722, rs80338725, rs80338719, rs80338723, rs80338726, rs121908636, rs121908638, rs121908639, rs121908640, rs121908641, rs121908642, rs121908643, rs121908644, rs121908645, rs121908646, rs121908647, rs80338721, rs80338724, rs80338715, rs80338727, rs80338729, rs80338716, rs80338717, rs398122839, rs398123130, rs192838388, rs148918985, rs398123131, rs371265106, rs727503814, rs786204648, rs770362721, rs786204537, rs786204460, rs751930594, rs771937610, rs777828000, rs80338720, rs1085307056, rs746155190, rs575001023, rs763389916, rs886039853, rs372128852, rs1057516960, rs1057516648, rs1057516544, rs1057516339, rs1057517259, rs982830431, rs762387914, rs1057516338, rs1057517402, rs763191789, rs1057520659, rs1060499612, rs765338121, rs758827458, rs1554725034, rs1439911743, rs936192871, rs1554725677, rs1554982237, rs756859126, rs1554982809, rs1554983719, rs1396766124, rs750780742, rs1554982824, rs1554722453, rs1554723160, rs1554723625, rs1554725033, rs1554982243, rs770944877, rs750214431, rs1213378896, rs1554982847, rs201623252, rs1554983717, rs1301613270, rs775791516, rs1564903969, rs1262020902, rs1562831765, rs962082210, rs748264993, rs1004492719, rs1261058897, rs771794639, rs761370420, rs768922690, rs1588475891, rs745404241, rs775305020, rs770585183, rs1313340299, rs374586230, rs1588495489, rs1588496214, rs1588508532, rs1312396424, rs1482630982, rs1846142146, rs549085827, rs1488840592 27604308, 11793471, 12424587, 21507300, 24327139, 24161253, 17880783, 16449956, 21507300, 10369257, 21134364, 21424115, 11281457, 15050970, 19470249, 12424587, 19036621, 24586645, 18392553, 14680984, 27604308
Unknown
Disease name Disease term dbSNP ID References
Cirrhosis Cirrhosis rs119465999, rs144369314, rs8056684, rs112053857, rs75998507
Delayed menarche Delayed menarche
Delirium Delirium
Delusions Delusions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412