TRAP1 (TNF receptor associated protein 1)

Gene

• Entrez ID: 10131
• Gene name: TNF receptor associated protein 1
• Gene symbol: TRAP1
• Synonyms: HSP 75, HSP75, HSP90L, TRAP-1
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stres

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs113476582	T>A,C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031812	hsa-miR-16-5p	Proteomics	18668040
MIRT049372	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT031812	hsa-miR-16-5p	CLASH	23622248
MIRT050940	hsa-miR-17-5p	CLASH	23622248
MIRT050345	hsa-miR-25-3p	CLASH	23622248
MIRT050189	hsa-miR-26a-5p	CLASH	23622248
MIRT049372	hsa-miR-92a-3p	CLASH	23622248
MIRT048268	hsa-miR-196a-5p	CLASH	23622248
MIRT048118	hsa-miR-197-3p	CLASH	23622248
MIRT046825	hsa-miR-222-3p	CLASH	23622248
MIRT045658	hsa-miR-149-5p	CLASH	23622248
MIRT045192	hsa-miR-186-5p	CLASH	23622248
MIRT043734	hsa-miR-342-3p	CLASH	23622248
MIRT043532	hsa-miR-331-3p	CLASH	23622248
MIRT043185	hsa-miR-324-5p	CLASH	23622248
MIRT042452	hsa-miR-424-5p	CLASH	23622248
MIRT041401	hsa-miR-193b-3p	CLASH	23622248
MIRT040106	hsa-miR-615-3p	CLASH	23622248
MIRT039132	hsa-miR-769-3p	CLASH	23622248
MIRT038265	hsa-miR-361-3p	CLASH	23622248
MIRT035913	hsa-miR-1180-3p	CLASH	23622248
MIRT035913	hsa-miR-1180-3p	CLASH	23622248
MIRT1451684	hsa-miR-3151	CLIP-seq
MIRT1451685	hsa-miR-3173-3p	CLIP-seq
MIRT1451686	hsa-miR-3689d	CLIP-seq
MIRT1451687	hsa-miR-4283	CLIP-seq
MIRT1451688	hsa-miR-4489	CLIP-seq
MIRT1451689	hsa-miR-4675	CLIP-seq
MIRT1451690	hsa-miR-4741	CLIP-seq
MIRT1451684	hsa-miR-3151	CLIP-seq
MIRT1451685	hsa-miR-3173-3p	CLIP-seq
MIRT2356356	hsa-miR-320a	CLIP-seq
MIRT2356357	hsa-miR-320b	CLIP-seq
MIRT2356358	hsa-miR-320c	CLIP-seq
MIRT2356359	hsa-miR-320d	CLIP-seq
MIRT2356360	hsa-miR-331-5p	CLIP-seq
MIRT1451686	hsa-miR-3689d	CLIP-seq
MIRT1451687	hsa-miR-4283	CLIP-seq
MIRT2356361	hsa-miR-4429	CLIP-seq
MIRT1451688	hsa-miR-4489	CLIP-seq
MIRT1451689	hsa-miR-4675	CLIP-seq
MIRT1451690	hsa-miR-4741	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005164	Function	Tumor necrosis factor receptor binding	NAS	7876093
GO:0005515	Function	Protein binding	IPI	17579517, 23564345, 23747254, 29128334
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IDA	17579517
GO:0005743	Component	Mitochondrial inner membrane	IBA	21873635
GO:0005743	Component	Mitochondrial inner membrane	IDA	23564345
GO:0005758	Component	Mitochondrial intermembrane space	ISS	17579517
GO:0005759	Component	Mitochondrial matrix	IDA	23564345
GO:0006457	Process	Protein folding	IBA	21873635
GO:0009386	Process	Translational attenuation	IMP	24113185
GO:0016020	Component	Membrane	HDA	19946888
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IPI	17579517
GO:0051082	Function	Unfolded protein binding	IBA	21873635
GO:0061077	Process	Chaperone-mediated protein folding	TAS	24522549
GO:1901856	Process	Negative regulation of cellular respiration	IMP	23564345
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	TAS	18221368
GO:1903751	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide	ISS	17579517

Other IDs

• MIM: 606219
• HGNC: 16264
• e!Ensembl: ENSG00000126602

Protein

• UniProt ID: Q12931
• Protein name: Heat shock protein 75 kDa, mitochondrial (HSP 75) (Heat shock protein family C member 5) (TNFR-associated protein 1) (Tumor necrosis factor type 1 receptor-associated protein) (TRAP-1)
• Protein function: Chaperone that expresses an ATPase activity. Involved in maintaining mitochondrial function and polarization, downstream of PINK1 and mitochondrial complex I. Is a negative regulator of mitochondrial respiration able to modulate the balance betw
• PDB: 4Z1F, 4Z1G, 4Z1H, 4Z1I, 5F3K, 5F5R, 5HPH, 5Y3N, 5Y3O, 6XG6, 7C04, 7C05, 7C7B, 7C7C, 7KCK, 7KCL, 7KCM, 7KLU, 7KLV, 7U8U, 7U8V, 7U8W, 7U8X, 7ULK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02518	HATPase_c	108 → 260	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain
  PF00183	HSP90	288 → 704	Hsp90 protein	Family

• Sequence:

  MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFS
  TQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNA
  SDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGS
  KAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFE
  IAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
  MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELG
  SSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ
  RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQL
  TSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLR
  EFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
  LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRAS
  EPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH

• Sequence length: 704

Pathways

KEGG:

Parkinson disease
Pathways of neurodegeneration - multiple diseases

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	18784066
Congenital anomalies of kidney and urinary tract	Cakut	rs267606865, rs121908436, rs281875326, rs879255515, rs75462234, rs869320679, rs760905589, rs797045022, rs869320624, rs745597204, rs1114167358, rs1555879360, rs1577330805, rs1008555507	24152966
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	21364753
Vacterl association	VATER/VACTERL ASSOCIATION	rs752504125, rs869320684, rs776556963	24152966

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	31039275
Osteoarthrosis deformans	Osteoarthrosis Deformans		18784066
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		21364753