CDH13 (cadherin 13)

Gene

• Entrez ID: 1012
• Gene name: Cadherin 13
• Gene symbol: CDH13
• Synonyms: CDHH, P105
• Chromosome: 16
• Chromosome location: 16q23.3
• Summary: This gene encodes a member of the cadherin superfamily. The encoded protein is localized to the surface of the cell membrane and is anchored by a GPI moiety, rather than by a transmembrane domain. The protein lacks the cytoplasmic domain characteristic of other cadherins, and so is not thought to be a cell-cell adhesion glycoprotein. This protein acts as a negative regulator of axon growth during neural differentiation. It also protects vascular endothelial cells from apoptosis due to oxidative stress, and is associated with resistance to atherosclerosis. The gene is hypermethylated in many types of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021007	hsa-miR-155-5p	Proteomics	18668040
MIRT024070	hsa-miR-1-3p	Proteomics	18668040
MIRT053689	hsa-miR-181a-5p	Microarray	22942087
MIRT617190	hsa-miR-4464	HITS-CLIP	23824327
MIRT617191	hsa-miR-4307	HITS-CLIP	23824327
MIRT617192	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT617193	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT617194	hsa-miR-31-3p	HITS-CLIP	23824327
MIRT617195	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT617196	hsa-miR-1266-3p	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
POU3F2	Unknown	23069940

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	15364621
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IMP	17573778
GO:0002040	Process	Sprouting angiogenesis	IBA	21873635
GO:0002040	Process	Sprouting angiogenesis	IDA	16873731
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005615	Component	Extracellular space	IDA	16873731
GO:0005737	Component	Cytoplasm	IDA	10737605
GO:0005886	Component	Plasma membrane	IDA	10737605
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	9650591
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA	21873635
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IDA	10601632
GO:0007162	Process	Negative regulation of cell adhesion	IDA	14729458
GO:0007266	Process	Rho protein signal transduction	IMP	15703273
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10737605
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	10601632
GO:0016342	Component	Catenin complex	IBA	21873635
GO:0016601	Process	Rac protein signal transduction	IMP	15703273
GO:0030032	Process	Lamellipodium assembly	IDA	15703273
GO:0030100	Process	Regulation of endocytosis	IMP	17573778
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	16013438
GO:0030335	Process	Positive regulation of cell migration	IDA	14729458
GO:0031225	Component	Anchored component of membrane	IEA
GO:0034332	Process	Adherens junction organization	TAS
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	IMP	17573778
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043005	Component	Neuron projection	IDA	10737605
GO:0043542	Process	Endothelial cell migration	IDA	14729458
GO:0043616	Process	Keratinocyte proliferation	IDA	15816843
GO:0045296	Function	Cadherin binding	IBA	21873635
GO:0045296	Function	Cadherin binding	IDA	10601632
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16099944
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IMP	15364621
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	16013438
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	16013438
GO:0051668	Process	Localization within membrane	IMP	17573778
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IDA	16013438
GO:0055100	Function	Adiponectin binding	ISS
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27559042
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071813	Function	Lipoprotein particle binding	IDA	11027617
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IBA	21873635
GO:0098982	Component	GABA-ergic synapse	IEA

Other IDs

• MIM: 601364
• HGNC: 1753
• e!Ensembl: ENSG00000140945

Protein

• UniProt ID: P55290
• Protein name: Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin)
• Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth.
• PDB: 2V37
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08758	Cadherin_pro	26 → 112	Cadherin prodomain like	Domain
  PF00028	Cadherin	143 → 236	Cadherin domain	Domain
  PF00028	Cadherin	250 → 354	Cadherin domain	Domain
  PF00028	Cadherin	368 → 469	Cadherin domain	Domain
  PF00028	Cadherin	483 → 576	Cadherin domain	Domain
  PF00028	Cadherin	588 → 680	Cadherin domain	Domain

• Sequence:

  MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKG
  NDKLRYEVSSPYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGS
  LQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGV
  DQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQND
  NRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY
  IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHS
  PKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN
  EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPD
  PMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLD
  RESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLS
  VVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIM
  VTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL

• Sequence length: 713

Pathways

Reactome:

Adherens junctions interactions

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605	27182965
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs-1, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	23358160
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs-1, rs121918529, rs121918531, rs137852340, rs405509, rs1555800701, rs1215189537	29212778, 30104761, 28714975, 28714974
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	18264096, 17288544
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs-1, rs1584238193	18337602
Leukemia	Leukemia, Myelocytic, Acute	rs-1, rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs-1, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	26830138
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	18729198
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	18337602
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease	rs-1	26503814

Unknown
Disease name	Disease term	dbSNP ID	References
Crohn disease	Crohn Disease	rs2066847, rs2066844, rs886052047, rs5743265, rs111608429, rs104895438	28067908
Barrett esophagus	Barrett Esophagus	rs41341748	18729198
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	22064162
Barrett epithelium	Barrett Epithelium		18729198
Erectile dysfunction	Erectile dysfunction		30583798
Liver carcinoma	Liver carcinoma		18425332, 28284560, 18553387
Lung neoplasms	Lung Neoplasms		18337602
Prostatic neoplasms	Prostatic Neoplasms		17288544, 18264096