Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
100506380 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
RNF32 divergent transcript |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
RNF32-DT |
SynonymsGene synonyms aliases
|
C7orf13, LINC01006, MY040 |
ChromosomeChromosome number
|
7 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
7q36.3 |
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q8NI28 |
Protein name |
Putative transmembrane protein RNF32-DT (RNF32 divergent transcript) |
Family and domains |
|
Sequence |
MLASPARPTLRMLANHALSTPHCACSPAPAPRTASASRRRCVPVEARAAGVFGDRLAGVF GSRGLKHGGVQAPRPRVVRAEPRAGFAVVRSPRRLCGRSHAPQPPAHLGLGPGCFPAVAV VVPVPGSRAHRPFAALLVEGSFLGDPPIPPRRSGVLARGSAGADCLASSVTPGPSLWIPL LLVAGCVSCFVGLAVCVWMQARVSPAWPAGLFLLPR
|
|
Sequence length |
216 |
Interactions |
View interactions |
Associated diseases
|
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Kidney failure |
Kidney Failure, Chronic |
|
31152163 |
Knee osteoarthritis |
Osteoarthritis, Knee |
|
28916551 |
|