Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
10046 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Mastermind like domain containing 1 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
MAMLD1 |
SynonymsGene synonyms aliases
|
CG1, CXorf6, F18, HYSP2 |
ChromosomeChromosome number
|
X |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
Xq28 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a mastermind-like domain containing protein. This protein may function as a transcriptional co-activator. Mutations in this gene are the cause of X-linked hypospadias type 2. Alternate splicing results in multiple transcript variants. [p |
SNPsSNP information provided by dbSNP.
|
SNP ID |
Visualize variation |
Clinical significance |
Consequence |
rs121909493 |
G>T |
Pathogenic |
Coding sequence variant, stop gained |
rs121909494 |
C>T |
Pathogenic |
Coding sequence variant, stop gained |
rs121909495 |
C>T |
Pathogenic |
Coding sequence variant, stop gained, intron variant |
rs1135402752 |
G>T |
Pathogenic |
Coding sequence variant, stop gained |
|
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q13495 |
Protein name |
Mastermind-like domain-containing protein 1 (F18) (Protein CG1) |
Protein function |
Transactivates the HES3 promoter independently of NOTCH proteins. HES3 is a non-canonical NOTCH target gene which lacks binding sites for RBPJ. |
Family and domains |
|
Sequence |
MDDWKSRLVIKSMLPHFAMVGNRQEPRKLQESGKKPSWMEEEDLSFLYKSSPGRKHQGTV KRRQEEDHFQFPDMADGGYPNKIKRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPA AMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELL EELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSHLESLASSKEFA SSCSQVTGMSLQIPSSSTGISYSIPSTSKQIVSPSSSMAQSKSQVQAMLPVALPPLPVPQ WHHAHQLKALAASKQGSATKQQGPTPSWSGLPPPGLSPPYRPVPSPHPPPLPLPPPPPPF SPQSLMVSCMSSNTLSGSTLRGSPNALLSSMTSSSNAALGPAMPYAPEKLPSPALTQQPQ FGPQSSILANLMSSTIKTPQGHLMSALPASNPGPSPPYRPEKLSSPGLPQQSFTPQCSLI RSLTPTSNLLSQQQQQQQQQQQANVIFKPISSNSSKTLSMIMQQGMASSSPGATEPFTFG NTKPLSHFVSEPGPQKMPSMPTTSRQPSLLHYLQQPTPTQASSATASSTATATLQLQQQQ QQQQQQPDHSSFLLQQMMQQPQRFQRSVASDSMPALPRQGCCHLFAWTSAASSVKPQHQH GNSFTSRQDPQPGDVSPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSF AHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
|
|
Sequence length |
774 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Cryptorchidism |
Cryptorchidism |
rs121912555, rs104894697, rs104894698, rs398122886 |
|
Hypospadias, x-linked |
Hypospadias 2, X-Linked |
rs137852574, rs121909493, rs121909494, rs121909495, rs1135402752, rs143040492 |
25660412, 17086185 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Blind vagina |
Blind vagina |
|
|
High palate |
Byzanthine arch palate |
|
|
Hypospadias |
Hypospadias, penoscrotal, Hypospadias, balanic, Hypospadias |
|
21559465 |
Myotubular myopathy with abnormal genital development |
Myotubular Myopathy with Abnormal Genital Development, X-linked myotubular myopathy-abnormal genitalia syndrome |
|
9169146, 26580071 |
Penile hypospadias |
Penile hypospadias |
|
|
Penis agenesis |
Penis agenesis |
|
|
|