LINC01387 (long intergenic non-protein coding RNA 1387)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
100130480 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Long intergenic non-protein coding RNA 1387 |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
LINC01387 |
SynonymsGene synonyms aliases
|
C18orf64 |
ChromosomeChromosome number
|
18 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
18p11.31 |
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
J3KSC0 |
Protein name |
Putative uncharacterized protein encoded by LINC01387 |
Family and domains |
|
Sequence |
MVPAPPFLGVLENPVPQWDLSILGSIRIRVSHTEVQGSGSSRSPEALRKESLEVEWTLVL LAIPPRIQPSQQDGGPPKCCDLLRAALLGRHCPLCVPAGEVFSQKRDNEQDRSEFIGQTL KLLVKRNVSLELSCR
|
|
Sequence length |
135 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Asthma |
Asthma |
rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 |
26025128 |
Hypothyroidism |
Hypothyroidism |
rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605 |
22493691 |
|
|
|
| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412 |