GediPNet logo

CDH2 (cadherin 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1000
Gene nameGene Name - the full gene name approved by the HGNC.
Cadherin 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CDH2
SynonymsGene synonyms aliases
ACOGS, ADHD8, ARVD14, CD325, CDHN, CDw325, NCAD
ChromosomeChromosome number
18
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q12.1
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell ad
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs199984052 T>A,C Pathogenic, uncertain-significance Missense variant, coding sequence variant
rs201775968 T>C,G Pathogenic Missense variant, coding sequence variant
rs754880999 G>A,C Pathogenic Synonymous variant, coding sequence variant, missense variant
rs1555630396 T>C Likely-pathogenic Missense variant, coding sequence variant
rs1598982483 ->AACA Pathogenic Coding sequence variant, frameshift variant, intron variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005821 hsa-miR-204-5p Microarray 21282569
MIRT005889 hsa-miR-194-5p Luciferase reporter assay, qRT-PCR, Western blot 20979124
MIRT005889 hsa-miR-194-5p Luciferase reporter assay, qRT-PCR, Western blot 20979124
MIRT007288 hsa-miR-145-5p Luciferase reporter assay, Western blot 22370644
MIRT021006 hsa-miR-155-5p Proteomics 19386588
Transcription factors
Transcription factor Regulation Reference
AR Activation 17297473;18535113
KLF8 Repression 20728449
MSX2 Repression 21730974
MZF1 Unknown 15541732
SNAI1 Unknown 21796367
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003323 Process Type B pancreatic cell development ISS
GO:0005509 Function Calcium ion binding IBA 21873635
GO:0005509 Function Calcium ion binding ISS
GO:0005515 Function Protein binding IPI 7650039, 17057644, 17098867, 17510365, 17679699, 18948590, 21357690, 29366904
GO:0005737 Component Cytoplasm IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P19022
Protein name Cadherin-2 (CDw325) (Neural cadherin) (N-cadherin) (CD antigen CD325)
Protein function Calcium-dependent cell adhesion protein; preferentially mediates homotypic cell-cell adhesion by dimerization with a CDH2 chain from another cell. Cadherins may thus contribute to the sorting of heterogeneous cell types. Acts as a regulator of n
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08758 Cadherin_pro
31 121
Cadherin prodomain like
Domain
PF00028 Cadherin
164 258
Cadherin domain
Domain
PF00028 Cadherin
272 373
Cadherin domain
Domain
PF00028 Cadherin
387 489
Cadherin domain
Domain
PF00028 Cadherin
502 596
Cadherin domain
Domain
PF00028 Cadherin
608 701
Cadherin domain
Domain
PF01049 Cadherin_C
751 904
Cadherin cytoplasmic region
Family
Sequence
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVK
L
SLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAV
DINGNQVENPIDIVINVI
DMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVT
DVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVI
DVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLL
DIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVC
QCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGG
DD
Sequence length 906
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cell adhesion molecules
Arrhythmogenic right ventricular cardiomyopathy
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Adherens junctions interactions
Myogenesis
Post-translational protein phosphorylation
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Arrhythmogenic right ventricular cardiomyopathy Familial isolated arrhythmogenic ventricular dysplasia, right dominant form rs63750743, rs121434420, rs121434421, rs193922674, rs111517471, rs137854613, rs113994177, rs121913006, rs121913008, rs121913011, rs121913003, rs121912992, rs397514041, rs386134243, rs193922672, rs193922673, rs397515925, rs397516712, rs397516784, rs397516913, rs397516915, rs397516919, rs397516923, rs397516929, rs397516932, rs397516933, rs397516940, rs397516943, rs397516946, rs397516955, rs397516986, rs397516987, rs397516989, rs372827156, rs397516992, rs397516993, rs397516994, rs397516996, rs397516997, rs397517001, rs397517003, rs397517005, rs397517008, rs397517009, rs397517010, rs397517012, rs397517013, rs397517015, rs397517017, rs397517021, rs397517022, rs397517025, rs397517030, rs397517393, rs587777134, rs587777135, rs140474226, rs145476705, rs727504443, rs727505077, rs727505260, rs727505271, rs727504786, rs727504430, rs727504432, rs727502993, rs730880082, rs730880092, rs786204393, rs786204392, rs786204389, rs786204388, rs786205476, rs786205353, rs760576804, rs794728708, rs397516510, rs794728137, rs794728111, rs1554108152, rs767643821, rs770873593, rs794728146, rs777573018, rs794728130, rs794728072, rs794728083, rs794728094, rs794728098, rs794729098, rs794729116, rs794729130, rs764817683, rs751288871, rs201405287, rs794729129, rs794729128, rs78897684, rs794729127, rs794729137, rs794729126, rs794729125, rs762103704, rs794729133, rs766209297, rs794729124, rs754912778, rs772220644, rs767987619, rs794729122, rs769220833, rs794729103, rs794729132, rs774663443, rs763639737, rs794729120, rs794729107, rs869025392, rs869025395, rs869025496, rs876657638, rs876657659, rs878853170, rs878854710, rs886039178, rs1114167345, rs886041322, rs781532110, rs1057517903, rs778178956, rs1060499940, rs1060500618, rs1060500607, rs1060500613, rs1064792927, rs1064792929, rs1064792928, rs1060501184, rs1060501186, rs1060501182, rs1555143134, rs750176752, rs1060502989, rs1064794350, rs1555142963, rs1064793231, rs1064796069, rs1064795963, rs758282201, rs1064793983, rs727505038, rs1554108410, rs1555143143, rs1555148271, rs1555149952, rs762288961, rs958681660, rs1555671201, rs1555627108, rs1554108287, rs1554105911, rs1554107839, rs1554107916, rs1554108610, rs1353074803, rs1555149975, rs1555145509, rs1425855043, rs1555639134, rs1555671441, rs763303290, rs878898365, rs1555142994, rs1555640399, rs1238227166, rs1555148032, rs1555144459, rs1555147210, rs1555148011, rs1555148035, rs1486464304, rs1554108929, rs1555142984, rs1453983744, rs1555145520, rs746173561, rs1555142971, rs1555148259, rs1555637555, rs1373300155, rs1554108477, rs1236464864, rs1555148048, rs1394836623, rs1561703922, rs113726158, rs1565599473, rs1565586921, rs1565586958, rs769022411, rs1568098570, rs1567933176, rs1375081885, rs1568105371, rs1039633976, rs1561703331, rs1565574709, rs766450773, rs1592729525, rs762753884, rs1598572298, rs759944835, rs1598810829, rs1581817513, rs1591828796, rs775256998, rs763907170, rs1187924885, rs1592738654, rs745457570, rs1581799453, rs1581816089, rs1318070848, rs1598592533, rs1435125402, rs1758912749, rs1464886350, rs1956192035, rs1396519956, rs930283260, rs1957127435, rs1987170019, rs752522753, rs2035287906
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243 27811057
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs10520699, rs11852999, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038 27811057
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074 17222817
Unknown
Disease name Disease term dbSNP ID References
Mammary neoplasms Mammary Neoplasms, Human, Mammary Neoplasms 27811057
Duane retraction syndrome Duane Retraction Syndrome rs121912838, rs574270883, rs375494218, rs886055152, rs547068631, rs66480716 17222817
Grand mal status epilepticus Grand Mal Status Epilepticus 12125071
Malformation of cortical development Malformations of Cortical Development, Group II 17222817

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412