Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1
Gene name	Alpha-1-B glycoprotein
Gene symbol	A1BG
Synonyms (NCBI Gene)	A1BABGGABHYST2477
Chromosome	19
Chromosome location	19q13.43
Summary	The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins. [provided by RefSeq, Jul 2008]

47 Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT683088	hsa-miR-141-3p	HITS-CLIP	23706177
MIRT683087	hsa-miR-200a-3p	HITS-CLIP	23706177
MIRT683086	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT683085	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT683084	hsa-miR-6742-3p	HITS-CLIP	23706177
MIRT683083	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT683082	hsa-miR-4772-3p	HITS-CLIP	23706177
MIRT683081	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT683080	hsa-miR-6776-5p	HITS-CLIP	23706177
MIRT683079	hsa-miR-4645-3p	HITS-CLIP	23706177
MIRT683078	hsa-miR-661	HITS-CLIP	23706177
MIRT683077	hsa-miR-1288-3p	HITS-CLIP	23706177
MIRT683076	hsa-miR-542-3p	HITS-CLIP	23706177
MIRT683075	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT683074	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT683073	hsa-miR-7703	HITS-CLIP	23706177
MIRT683072	hsa-miR-1262	HITS-CLIP	23706177
MIRT683071	hsa-miR-4701-3p	HITS-CLIP	23706177
MIRT683070	hsa-miR-6736-5p	HITS-CLIP	23706177
MIRT683069	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT732287	hsa-miR-5582-5p	Luciferase reporter assayqRT-PCRWestern blot	27475256
MIRT732287	hsa-miR-5582-5p	Luciferase reporter assayqRT-PCRWestern blot	27475256
MIRT732287	hsa-miR-5582-5p	Luciferase reporter assayqRT-PCRWestern blot	27475256
MIRT732287	hsa-miR-5582-5p	Luciferase reporter assayqRT-PCRWestern blot	27475256
MIRT683088	hsa-miR-141-3p	HITS-CLIP	23706177
MIRT683087	hsa-miR-200a-3p	HITS-CLIP	23706177
MIRT683086	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT683085	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT683084	hsa-miR-6742-3p	HITS-CLIP	23706177
MIRT683083	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT683082	hsa-miR-4772-3p	HITS-CLIP	23706177
MIRT683081	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT683080	hsa-miR-6776-5p	HITS-CLIP	23706177
MIRT683079	hsa-miR-4645-3p	HITS-CLIP	23706177
MIRT683078	hsa-miR-661	HITS-CLIP	23706177
MIRT683077	hsa-miR-1288-3p	HITS-CLIP	23706177
MIRT683076	hsa-miR-542-3p	HITS-CLIP	23706177
MIRT683075	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT683074	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT683073	hsa-miR-7703	HITS-CLIP	23706177
MIRT683072	hsa-miR-1262	HITS-CLIP	23706177
MIRT683071	hsa-miR-4701-3p	HITS-CLIP	23706177
MIRT683070	hsa-miR-6736-5p	HITS-CLIP	23706177
MIRT683069	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT1923096	hsa-miR-3126-5p	CLIP-seq
MIRT1923097	hsa-miR-4419a	CLIP-seq
MIRT1923098	hsa-miR-4510	CLIP-seq

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IDA	3458201
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005886	Component	Plasma membrane	IBA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
138670	5	ENSG00000121410

P04217

Protein name

Alpha-1B-glycoprotein (Alpha-1-B glycoprotein)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	209 → 301	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Plasma.

Sequence

MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQL
FKNGVAQEPVHLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPW
LSMAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNY
SCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVD
FQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYRLHDNQNGWSGDSAPVELI
LSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFE
LHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV
LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTF
ESELSDPVELLVAES

Sequence length

495

Interactions

View interactions

Reactome Pathway
Platelet degranulation
Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEPATOMEGALY	—	CTD	28108177	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	25821032	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (36)
Adenocarcinoma	Adenocarcinoma	LHGDN	18706098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22232349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	18973555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	31708865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30770760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	30770760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23418544	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36344648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	10542268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	31077404		★★★★★ ★☆☆☆☆ Found in Text Mining only

A1BG (alpha-1-B glycoprotein)

Bookmark This Gene