Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	7704
Gene name	Zinc finger and BTB domain containing 16
Gene symbol	ZBTB16
Synonyms (NCBI Gene)	PLZFZNF145
Chromosome	11
Chromosome location	11q23.2
Summary	This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434606	A>G	Pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant

167

Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT718189	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT718188	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT718187	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT718186	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT707766	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT520003	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT520004	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520001	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT520003	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT520004	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT520002	hsa-miR-6083	HITS-CLIP	23313552
MIRT520001	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT651400	hsa-miR-1470	HITS-CLIP	23824327
MIRT651401	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT651398	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT651399	hsa-miR-5193	HITS-CLIP	23824327
MIRT651397	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT651396	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT651395	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT651394	hsa-miR-4469	HITS-CLIP	23824327
MIRT651393	hsa-miR-4287	HITS-CLIP	23824327
MIRT651392	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT651391	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT651390	hsa-miR-1976	HITS-CLIP	23824327
MIRT651389	hsa-miR-4284	HITS-CLIP	23824327
MIRT651388	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT651387	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT651386	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT651385	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT651384	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT651402	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT651400	hsa-miR-1470	HITS-CLIP	23824327
MIRT651401	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT651398	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT651399	hsa-miR-5193	HITS-CLIP	23824327
MIRT651397	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT651396	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT651395	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT651394	hsa-miR-4469	HITS-CLIP	23824327
MIRT651393	hsa-miR-4287	HITS-CLIP	23824327
MIRT651392	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT651391	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT651390	hsa-miR-1976	HITS-CLIP	23824327
MIRT651389	hsa-miR-4284	HITS-CLIP	23824327
MIRT651388	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT651387	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT651386	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT651385	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT651384	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT564842	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT564841	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT564839	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564840	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT564838	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT564837	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT564836	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT564835	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT564834	hsa-miR-3908	PAR-CLIP	20371350
MIRT564832	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT564833	hsa-miR-4690-3p	PAR-CLIP	20371350
MIRT564831	hsa-miR-5685	PAR-CLIP	20371350
MIRT564830	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT564829	hsa-miR-3145-3p	PAR-CLIP	20371350
MIRT564828	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT564842	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT564841	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT564839	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564840	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT564838	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT564837	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT564836	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT564835	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT564834	hsa-miR-3908	PAR-CLIP	20371350
MIRT564832	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT564833	hsa-miR-4690-3p	PAR-CLIP	20371350
MIRT564831	hsa-miR-5685	PAR-CLIP	20371350
MIRT564830	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT564829	hsa-miR-3145-3p	PAR-CLIP	20371350
MIRT564828	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT520003	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT520004	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520002	hsa-miR-6083	PAR-CLIP	23446348
MIRT520001	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT718189	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT718188	hsa-miR-361-3p	HITS-CLIP	19536157
MIRT718187	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT718186	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT707766	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT520003	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT520004	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520001	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT520003	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT520004	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT520002	hsa-miR-6083	HITS-CLIP	23313552
MIRT520001	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT651400	hsa-miR-1470	HITS-CLIP	23824327
MIRT651401	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT651398	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT651399	hsa-miR-5193	HITS-CLIP	23824327
MIRT651397	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT651396	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT651395	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT651394	hsa-miR-4469	HITS-CLIP	23824327
MIRT651393	hsa-miR-4287	HITS-CLIP	23824327
MIRT651392	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT651391	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT651390	hsa-miR-1976	HITS-CLIP	23824327
MIRT651389	hsa-miR-4284	HITS-CLIP	23824327
MIRT651388	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT651387	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT651386	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT651385	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT651384	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT651402	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT651400	hsa-miR-1470	HITS-CLIP	23824327
MIRT651401	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT651398	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT651399	hsa-miR-5193	HITS-CLIP	23824327
MIRT651397	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT651396	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT651395	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT651394	hsa-miR-4469	HITS-CLIP	23824327
MIRT651393	hsa-miR-4287	HITS-CLIP	23824327
MIRT651392	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT651391	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT651390	hsa-miR-1976	HITS-CLIP	23824327
MIRT651389	hsa-miR-4284	HITS-CLIP	23824327
MIRT651388	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT651387	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT651386	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT651385	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT651384	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT564842	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT564841	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT564839	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564840	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT564838	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT564837	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT564836	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT564835	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT564834	hsa-miR-3908	PAR-CLIP	20371350
MIRT564832	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT564833	hsa-miR-4690-3p	PAR-CLIP	20371350
MIRT564831	hsa-miR-5685	PAR-CLIP	20371350
MIRT564830	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT564829	hsa-miR-3145-3p	PAR-CLIP	20371350
MIRT564828	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT564842	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT564841	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT564839	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564840	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT564838	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT564837	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT564836	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT564835	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT564834	hsa-miR-3908	PAR-CLIP	20371350
MIRT564832	hsa-miR-4699-3p	PAR-CLIP	20371350
MIRT564833	hsa-miR-4690-3p	PAR-CLIP	20371350
MIRT564831	hsa-miR-5685	PAR-CLIP	20371350
MIRT564830	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT564829	hsa-miR-3145-3p	PAR-CLIP	20371350
MIRT564828	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT520003	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT520004	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520002	hsa-miR-6083	PAR-CLIP	23446348
MIRT520001	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT2150939	hsa-miR-4540	CLIP-seq

Show/Hide all (74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10688654, 12802276
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10688654, 12802276
GO:0001222	Function	Transcription corepressor binding	IPI	10688654
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12802276
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001501	Process	Skeletal system development	IEA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0001823	Process	Mesonephros development	IEA
GO:0001823	Process	Mesonephros development	ISS	8541544
GO:0003677	Function	DNA binding	IDA	12802276
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	9294197
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	9294197, 10980608, 16169070, 16189514, 16676348, 16828757, 17118363, 17500595, 19648967, 21988832, 23088713, 23414517, 24359566, 25241761, 25416956, 26871637, 27107012, 29997244, 32296183, 32814053, 36931259, 37398436
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9294197, 11929873, 21547890, 24359566
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	NAS	9294197
GO:0007417	Process	Central nervous system development	IEA
GO:0007417	Process	Central nervous system development	ISS	8541544
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IDA	19648967, 24359566
GO:0016604	Component	Nuclear body	IEA
GO:0016605	Component	PML body	IDA	9294197
GO:0016607	Component	Nuclear speck	IDA	8541544
GO:0017053	Component	Transcription repressor complex	IDA	12802276
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030097	Process	Hemopoiesis	IDA	8541544
GO:0030097	Process	Hemopoiesis	IEA
GO:0030097	Process	Hemopoiesis	TAS	9294197
GO:0030099	Process	Myeloid cell differentiation	TAS	9294197
GO:0031703	Function	Type 2 angiotensin receptor binding	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IMP	21547890
GO:0032991	Component	Protein-containing complex	IMP	10980608
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0035136	Process	Forelimb morphogenesis	IEA
GO:0035137	Process	Hindlimb morphogenesis	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IPI	9294197, 25416956, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	8622986
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043931	Process	Ossification involved in bone maturation	IEA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	21547890
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IEA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	ISS	8541544
GO:0045778	Process	Positive regulation of ossification	IDA	21547890
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12802276
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	24359566
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	9294197
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	21547890
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048133	Process	Male germ-line stem cell asymmetric division	IEA
GO:0051138	Process	Positive regulation of NK T cell differentiation	IEA
GO:0051216	Process	Cartilage development	IDA	21547890
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0061036	Process	Positive regulation of cartilage development	IDA	21547890
GO:2000026	Process	Regulation of multicellular organismal development	IEA

MIM	HGNC	e!Ensembl
176797	12930	ENSG00000109906

Q05516

Protein name

Zinc finger and BTB domain-containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF)

Protein function

Acts as a transcriptional repressor (PubMed:10688654, PubMed:24359566). Transcriptional repression may be mediated through recruitment of histone deacetylases to target promoters (PubMed:10688654). May play a role in myeloid maturation and in th

PDB

1BUO , 1CS3 , 8YTH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	24 → 126	BTB/POZ domain	Domain
PF13912	zf-C2H2_6	460 → 485		Domain
PF00096	zf-C2H2	491 → 512	Zinc finger, C2H2 type	Domain
PF13912	zf-C2H2_6	517 → 542		Domain
PF00096	zf-C2H2	546 → 568	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	574 → 596	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Within the hematopoietic system, PLZF is expressed in bone marrow, early myeloid cell lines and peripheral blood mononuclear cells. Also expressed in the ovary, and at lower levels, in the kidney and lung.

Sequence

MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV

Sequence length

673

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Malignant tumor of urinary bladder	Likely benign	rs143295857	RCV005907430
See cases	Uncertain significance	rs763360681	RCV002252467
Skeletal defects, genital hypoplasia, and intellectual disability	Uncertain significance	rs121434606	RCV000014305
ZBTB16-related disorder	Likely benign	rs749597976, rs116547293, rs145655784, rs745894313, rs201372671, rs111746546, rs142709090	RCV003909675 RCV003964152 RCV003949659 RCV003947195 RCV003958974 RCV003971725 RCV003905910

Show/Hide Text Mining Associations (62)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aberrant Crypt Foci	Associate	24348178
Adenocarcinoma of Lung	Associate	32998690
Adenoma	Associate	24990570
Adenomatous Polyposis Coli	Associate	24990570
Aortic Aneurysm Abdominal	Associate	29439675
Ataxia Telangiectasia	Associate	22555178
Bone Marrow Diseases	Associate	22555178
Breast Neoplasms	Associate	26070530, 37902007
Carcinogenesis	Associate	24348178, 25807461, 25990457, 33414372
Carcinoma Renal Cell	Associate	36530957
Cell Transformation Viral	Associate	19451220
Central Serous Chorioretinopathy	Associate	34546342
Cleft Palate	Associate	34382870
Colorectal Neoplasms	Associate	20945532
Colorectal Neoplasms	Stimulate	24348178
Disseminated Intravascular Coagulation	Associate	34042280
Emanuel syndrome	Associate	10500192, 18000064, 7849296
Endodermal Sinus Tumor	Associate	26916077, 28581124
Esophageal Neoplasms	Associate	34329340
Exfoliation Syndrome	Associate	24990570
Fever	Inhibit	36216898
Gastroschisis	Associate	31145102
Graves Disease	Associate	25122677
Heart Defects Congenital	Associate	27670201
HIV Infections	Associate	29616021
Hydatidiform Mole	Associate	26121690
Hypertension Pulmonary	Associate	33414372
Infections	Associate	36693920
Inflammation	Associate	31145102, 37856221
Intervertebral disc disease	Associate	35767190
Intestinal Polyposis	Associate	20945532
Leukemia	Associate	11090081, 19451220, 20945532, 22555178, 23898169, 31378879, 9256429
Leukemia Myeloid	Associate	19451220
Leukemia Myeloid Acute	Associate	18000064, 23091311, 31378879, 34042280
Leukemia Promyelocytic Acute	Associate	10500192, 10938130, 10942370, 11243468, 11703323, 11719366, 11865059, 11929748, 11964310, 12130525, 12893766, 14527952, 14551142, 14645547, 15114596 View all (18 more)
Lung Neoplasms	Associate	33414372
Lymphatic Metastasis	Associate	24990570
Mesothelioma Malignant	Inhibit	20010871
Multiple Sclerosis	Associate	31064978, 31681293
Neoplasm Metastasis	Inhibit	25807461
Neoplasms	Associate	11287007, 17360752, 20698843, 20945532, 25990457, 28038473, 33130899, 33414372
Neoplasms	Inhibit	17218380, 25807461, 30602500, 31444154, 33221764, 35422093
Neoplasms Germ Cell and Embryonal	Associate	26916077
Obesity	Stimulate	24348178
Obesity	Associate	28948827
Paraparesis Tropical Spastic	Associate	28384290
Peritoneal Diseases	Inhibit	33221764
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20435142, 22555178
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	29279377
Prostate Cancer Hereditary 7	Associate	25807461
Prostatic Neoplasms	Associate	23798432, 25807461, 30602500, 32343676
Prostatic Neoplasms	Inhibit	31444154
Prostatic Neoplasms Castration Resistant	Associate	26000489
Sarcoma Ewing	Associate	34660783
Sezary Syndrome	Associate	20698843
Squamous Cell Carcinoma of Head and Neck	Associate	28038473
Stomach Neoplasms	Inhibit	33221764
Tetra amelia with ectodermal dysplasia and lacrimal duct abnormalities	Associate	22555178
Thyroid Cancer Papillary	Associate	24990570
Thyroid Carcinoma Anaplastic	Associate	24990570
Thyroid Diseases	Associate	24990570
Thyroid Neoplasms	Associate	24990570

ZBTB16 (zinc finger and BTB domain containing 16)