Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10163
Gene name Gene Name - the full gene name approved by the HGNC.
WASP family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WASF2
Synonyms (NCBI Gene) Gene synonyms aliases
IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007243 hsa-miR-146a-5p Luciferase reporter assay 23435376
MIRT007243 hsa-miR-146a-5p Luciferase reporter assay 23435376
MIRT022583 hsa-miR-124-3p Microarray 18668037
MIRT023756 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT025275 hsa-miR-34a-5p Proteomics 21566225
Transcription factors
Transcription factor Regulation Reference
FOXF2 Activation 19562724
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001667 Process Ameboidal-type cell migration IEA
GO:0001726 Component Ruffle IEA
GO:0001764 Process Neuron migration IEA
GO:0003779 Function Actin binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605875 12733 ENSG00000158195
Protein
UniProt ID Q9Y6W5
Protein name Actin-binding protein WASF2 (Protein WAVE-2) (Verprolin homology domain-containing protein 2) (Wiskott-Aldrich syndrome protein family member 2) (WASP family protein member 2)
Protein function Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formatio
PDB 2A40
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02205 WH2 433 460 WH2 motif Family
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle. {ECO:0000269|PubMed:10381382}.
Sequence
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
Sequence length 498
Interactions View interactions
<