Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7454
Gene name Gene Name - the full gene name approved by the HGNC.
WASP actin nucleation promoting factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WAS
Synonyms (NCBI Gene) Gene synonyms aliases
IMD2, SCNX, THC, THC1, WASP, WASPA
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.23
Summary Summary of gene provided in NCBI Entrez Gene.
The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that the
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs132630268 G>A,C,T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs132630269 C>T Pathogenic Coding sequence variant, missense variant
rs132630270 C>G Pathogenic Coding sequence variant, missense variant
rs132630271 C>A,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs132630272 T>C Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1488620 hsa-miR-1207-5p CLIP-seq
MIRT1488621 hsa-miR-1224-5p CLIP-seq
MIRT1488622 hsa-miR-1262 CLIP-seq
MIRT1488623 hsa-miR-1294 CLIP-seq
MIRT1488624 hsa-miR-3147 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ETS1 Unknown 10066431
MYB Unknown 10066431
SP1 Unknown 10066431
SPI1 Unknown 10066431
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002625 Process Regulation of T cell antigen processing and presentation IMP 22804504
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 8892607, 9405671, 9422512, 9660763, 10202051, 12029088, 12235133, 12591280, 15169891, 15361624, 16488394, 17213309, 17242350, 18650809, 19234535, 19487689, 19805221, 19817875, 20936779, 21516116, 21988832, 22252508, 25416956, 25502805, 29248492, 31515488, 32296183
GO:0005634 Component Nucleus IDA 20574068, 29925947
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300392 12731 ENSG00000015285
Protein
UniProt ID P42768
Protein name Actin nucleation-promoting factor WAS (Wiskott-Aldrich syndrome protein) (WASp)
Protein function Effector protein for Rho-type GTPases that regulates actin filament reorganization via its interaction with the Arp2/3 complex (PubMed:12235133, PubMed:12769847, PubMed:16275905). Important for efficient actin polymerization (PubMed:12235133, Pu
PDB 1CEE , 1EJ5 , 1T84 , 2A3Z , 2K42 , 2OT0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00568 WH1 36 145 WH1 domain Domain
PF00786 PBD 237 296 P21-Rho-binding domain Domain
PF02205 WH2 427 454 WH2 motif Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the thymus. Also found, to a much lesser extent, in the spleen. {ECO:0000269|PubMed:8069912}.
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEDEAQAFRALVQEKI
QKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIED
QGGL
EAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD
Sequence length 502
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Severe Congenital Neutropenia, X-Linked x-linked severe congenital neutropenia rs1602178267, rs387906716, rs387906717, rs1557007165, rs132630274 N/A
thrombocytopenia Thrombocytopenia 1, Thrombocytopenia rs132630270, rs1602180058, rs1057517845, rs1557007312, rs886039451, rs132630273, rs1569494025, rs139265251, rs132630269, rs782290433 N/A
Wiskott-Aldrich Syndrome wiskott-aldrich syndrome rs1057517845, rs1557006672, rs1602178087, rs132630271, rs1557007312, rs1602177733, rs2062432605, rs886039451, rs587776742, rs587776745, rs2062432653, rs587776743, rs1557006239, rs2062410421, rs1602176299
View all (18 more)
N/A
Thrombocytopenia, X-Linked thrombocytopenia, x-linked, intermittent rs132630276, rs132630275 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 9024694
Anemia Hemolytic Autoimmune Associate 31354712
Arthritis Rheumatoid Associate 40048636
Autoimmune Diseases Associate 24872192, 31354712, 37478401
Bacterial Infections Associate 12969986
Blast Crisis Inhibit 29022901
Blood Platelet Disorders Associate 10397718, 9376590
Bruton type agammaglobulinemia Associate 10590061, 10688822, 22927353, 30564228
Carcinogenesis Inhibit 29022901
Carcinoma Renal Cell Associate 37122750