VEGFD (vascular endothelial growth factor D)

Gene

• Entrez ID: 2277
• Gene name: Vascular endothelial growth factor D
• Gene symbol: VEGFD
• Synonyms (NCBI Gene): FIGF, VEGF-D
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a compl

Transcription factors

Transcription factor	Regulation	Reference
FOS	Unknown	19136250
JUN	Unknown	19136250
NFKB1	Activation	18941249
RELA	Activation	18941249

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001666	Process	Response to hypoxia	IBA
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0005161	Function	Platelet-derived growth factor receptor binding	TAS	9479493
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IEA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IPI	9435229
GO:0005515	Function	Protein binding	IPI	27107012
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	9479493
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	9479493
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA
GO:0042056	Function	Chemoattractant activity	IBA
GO:0042056	Function	Chemoattractant activity	IDA	19275959
GO:0042802	Function	Identical protein binding	IEA
GO:0043185	Function	Vascular endothelial growth factor receptor 3 binding	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0050930	Process	Induction of positive chemotaxis	IDA	19275959
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IDA	19275959
GO:0071542	Process	Dopaminergic neuron differentiation	IEA

Other IDs

• MIM: 300091
• HGNC: 3708
• e!Ensembl: ENSG00000165197

Protein

• UniProt ID: O43915
• Protein name: Vascular endothelial growth factor D (VEGF-D) (c-Fos-induced growth factor) (FIGF)
• Protein function: Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphat
• PDB: 2XV7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	111 → 191	PDGF/VEGF domain	Domain
  PF03128	CXCXC	262 → 273	CXCXC repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas.
• Sequence:

  MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
  DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
  ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
  VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
  NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
  CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP

• Sequence length: 354