Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7423
Gene name	Vascular endothelial growth factor B
Gene symbol	VEGFB
Synonyms (NCBI Gene)	VEGFLVRF
Chromosome	11
Chromosome location	11q13.1
Summary	This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a lig

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT651751	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT651750	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT651749	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT651748	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT651747	hsa-miR-940	HITS-CLIP	23824327
MIRT651746	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT651745	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT651744	hsa-miR-4514	HITS-CLIP	23824327
MIRT651743	hsa-miR-4692	HITS-CLIP	23824327
MIRT651742	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT651741	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT651740	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT651739	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT651738	hsa-miR-4448	HITS-CLIP	23824327
MIRT651737	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT651736	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT651735	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT651734	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT651751	hsa-miR-361-5p	HITS-CLIP	23824327
MIRT651750	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT651749	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT651748	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT651747	hsa-miR-940	HITS-CLIP	23824327
MIRT651746	hsa-miR-7845-5p	HITS-CLIP	23824327
MIRT651745	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT651744	hsa-miR-4514	HITS-CLIP	23824327
MIRT651743	hsa-miR-4692	HITS-CLIP	23824327
MIRT651742	hsa-miR-211-3p	HITS-CLIP	23824327
MIRT651741	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT651740	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT651739	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT651738	hsa-miR-4448	HITS-CLIP	23824327
MIRT651737	hsa-miR-1207-5p	HITS-CLIP	23824327
MIRT651736	hsa-miR-4763-3p	HITS-CLIP	23824327
MIRT651735	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT651734	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT755508	hsa-miR-5194	Luciferase reporter assayWestern blottingqRT-PCR	37215458
MIRT755508	hsa-miR-5194	Luciferase reporter assayWestern blottingqRT-PCR	37215458
MIRT1483896	hsa-miR-1233	CLIP-seq
MIRT1483897	hsa-miR-298	CLIP-seq
MIRT2145650	hsa-miR-224	CLIP-seq
MIRT2145651	hsa-miR-3620	CLIP-seq
MIRT2145652	hsa-miR-370	CLIP-seq
MIRT2145653	hsa-miR-4663	CLIP-seq
MIRT2145654	hsa-miR-4766-5p	CLIP-seq
MIRT2145655	hsa-miR-627	CLIP-seq
MIRT2145656	hsa-miR-924	CLIP-seq
MIRT2659678	hsa-miR-101	CLIP-seq
MIRT1483896	hsa-miR-1233	CLIP-seq
MIRT2659679	hsa-miR-1236	CLIP-seq
MIRT2659680	hsa-miR-125a-5p	CLIP-seq
MIRT2659681	hsa-miR-125b	CLIP-seq
MIRT2659682	hsa-miR-1266	CLIP-seq
MIRT2659683	hsa-miR-136	CLIP-seq
MIRT1483897	hsa-miR-298	CLIP-seq
MIRT2659684	hsa-miR-3145-5p	CLIP-seq
MIRT2659685	hsa-miR-3160-3p	CLIP-seq
MIRT2659686	hsa-miR-331-3p	CLIP-seq
MIRT2659687	hsa-miR-3664-5p	CLIP-seq
MIRT2659688	hsa-miR-3682-3p	CLIP-seq
MIRT2659689	hsa-miR-3921	CLIP-seq
MIRT2659690	hsa-miR-4251	CLIP-seq
MIRT2659691	hsa-miR-4270	CLIP-seq
MIRT2659692	hsa-miR-4279	CLIP-seq
MIRT2659693	hsa-miR-4319	CLIP-seq
MIRT2659694	hsa-miR-4329	CLIP-seq
MIRT2659695	hsa-miR-4441	CLIP-seq
MIRT2659696	hsa-miR-4487	CLIP-seq
MIRT2659697	hsa-miR-4501	CLIP-seq
MIRT2659698	hsa-miR-4518	CLIP-seq
MIRT2659699	hsa-miR-4645-3p	CLIP-seq
MIRT2659700	hsa-miR-4653-5p	CLIP-seq
MIRT2659701	hsa-miR-4687-5p	CLIP-seq
MIRT2659702	hsa-miR-4713-5p	CLIP-seq
MIRT2659703	hsa-miR-4726-3p	CLIP-seq
MIRT2659704	hsa-miR-4757-5p	CLIP-seq
MIRT2659705	hsa-miR-4774-5p	CLIP-seq
MIRT2659706	hsa-miR-508-5p	CLIP-seq
MIRT2659707	hsa-miR-558	CLIP-seq
MIRT2659678	hsa-miR-101	CLIP-seq
MIRT1483896	hsa-miR-1233	CLIP-seq
MIRT2659679	hsa-miR-1236	CLIP-seq
MIRT2659680	hsa-miR-125a-5p	CLIP-seq
MIRT2659681	hsa-miR-125b	CLIP-seq
MIRT2659682	hsa-miR-1266	CLIP-seq
MIRT2659683	hsa-miR-136	CLIP-seq
MIRT1483897	hsa-miR-298	CLIP-seq
MIRT2659684	hsa-miR-3145-5p	CLIP-seq
MIRT2659685	hsa-miR-3160-3p	CLIP-seq
MIRT2659686	hsa-miR-331-3p	CLIP-seq
MIRT2659687	hsa-miR-3664-5p	CLIP-seq
MIRT2659688	hsa-miR-3682-3p	CLIP-seq
MIRT2659691	hsa-miR-4270	CLIP-seq
MIRT2659692	hsa-miR-4279	CLIP-seq
MIRT2659693	hsa-miR-4319	CLIP-seq
MIRT2659695	hsa-miR-4441	CLIP-seq
MIRT2659696	hsa-miR-4487	CLIP-seq
MIRT2659697	hsa-miR-4501	CLIP-seq
MIRT2659698	hsa-miR-4518	CLIP-seq
MIRT2659699	hsa-miR-4645-3p	CLIP-seq
MIRT2659701	hsa-miR-4687-5p	CLIP-seq
MIRT2659702	hsa-miR-4713-5p	CLIP-seq
MIRT2659704	hsa-miR-4757-5p	CLIP-seq
MIRT2659705	hsa-miR-4774-5p	CLIP-seq
MIRT2659706	hsa-miR-508-5p	CLIP-seq
MIRT2659707	hsa-miR-558	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
FOXM1	Unknown	21860419
FOXO3	Unknown	21860419
HDGF	Activation	14662017
HIF1A	Unknown	21731766
STAT3	Unknown	16899623;21731766
WT1	Unknown	17127464
YY1	Activation	20660740

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	8637916, 11122379
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	11122379, 19483306, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8637916, 12881472
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0007507	Process	Heart development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	18259607
GO:0016020	Component	Membrane	IEA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA	18259607
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0035470	Process	Positive regulation of vascular wound healing	IDA	16109918
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA
GO:0042056	Function	Chemoattractant activity	IBA
GO:0042056	Function	Chemoattractant activity	IDA	19275959
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18259607
GO:0043117	Process	Positive regulation of vascular permeability	IDA	16109918
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IPI	12366396, 16109918
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	18259607
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	11122379
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0050930	Process	Induction of positive chemotaxis	IDA	19275959
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	18259607
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IDA	19275959
GO:0060976	Process	Coronary vasculature development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18259607

MIM	HGNC	e!Ensembl
601398	12681	ENSG00000173511

P49765

Protein name

Vascular endothelial growth factor B (VEGF-B) (VEGF-related factor) (VRF)

Protein function

Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.

PDB

2C7W , 2VWE , 2XAC , 6TKK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00341	PDGF	47 → 124	PDGF/VEGF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.

Sequence

MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
STTSALTPGPAAAAADAAASSVAKGGA

Sequence length

207

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Uncertain significance	rs140652999	RCV005929056
Familial cancer of breast	Benign	rs12366035	RCV005905057
Malignant lymphoma, large B-cell, diffuse	Benign	rs12366035	RCV005905058
Melanoma	Uncertain significance	rs140652999	RCV005929057

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Associate	36564776
Alzheimer Disease	Stimulate	31332262
Alzheimer Disease	Associate	36680854, 36905877, 37354922
Behcet Syndrome	Associate	30420902
Breast Neoplasms	Associate	10551327
Carcinoma Hepatocellular	Associate	34845413, 36157115
Carcinoma Non Small Cell Lung	Associate	19197998, 25424698
Cardiovascular Diseases	Associate	36875456
Colonic Neoplasms	Associate	39527375
Colorectal Neoplasms	Associate	26355232, 32429465
Colorectal Neoplasms	Stimulate	34096454, 39527375
Diabetic Retinopathy	Associate	32836220
Dysplastic Nevus Syndrome	Associate	18317782
Elbow Tendinopathy	Associate	39684876
End Stage Liver Disease	Associate	19197998
Endometrial Neoplasms	Inhibit	12942123
Endometrial Neoplasms	Associate	31322068
Focal cortical dysplasia of Taylor	Associate	18317782
Giant Cell Tumor of Bone	Associate	35695550
Glaucoma Angle Closure	Associate	26988898
Glaucoma Open Angle	Associate	26988898
Heart Failure	Associate	39684876
Hemorrhage	Stimulate	36564776
Insulin Resistance	Inhibit	22471305
Intracranial Arteriosclerosis	Associate	30392834
Moyamoya Disease	Stimulate	30392834
Multiple Myeloma	Associate	34852710
Neoplasm Metastasis	Stimulate	23728940
Neoplasm Metastasis	Associate	25424698, 25880726, 27535973, 31173206, 34076988
Neoplasms	Stimulate	15107801, 19816005
Neoplasms	Associate	23148666, 23697367, 25880726, 31322068, 34845413, 36157115, 39527375, 9665470
Osteonecrosis	Stimulate	22035487
Ovarian Neoplasms	Associate	23965899
Pancreatic Neoplasms	Associate	15952180
Stomach Neoplasms	Associate	32754268
Thrombophlebitis	Associate	30420902
Uterine Hemorrhage	Associate	36564776
Vascular System Injuries	Associate	30420902

VEGFB (vascular endothelial growth factor B)