Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7415
Gene name Gene Name - the full gene name approved by the HGNC.
Valosin containing protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VCP
Synonyms (NCBI Gene) Gene synonyms aliases
CDC48, FTDALS6, TERA, p97
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the AAA ATPase family of proteins. The encoded protein plays a role in protein degradation, intracellular membrane fusion, DNA repair and replication, regulation of the cell cycle, and activation of the NF-kappa B pathway. Th
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121909329 C>A,G,T Pathogenic Coding sequence variant, missense variant
rs121909330 G>A,C,T Likely-pathogenic, pathogenic, uncertain-significance Coding sequence variant, missense variant
rs121909331 G>T Pathogenic Coding sequence variant, missense variant
rs121909332 G>A,C Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs121909334 C>T Pathogenic-likely-pathogenic, pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029447 hsa-miR-26b-5p Microarray 19088304
MIRT048477 hsa-miR-100-5p CLASH 23622248
MIRT048237 hsa-miR-196a-5p CLASH 23622248
MIRT046614 hsa-miR-222-3p CLASH 23622248
MIRT044062 hsa-miR-361-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
ELF2 Activation 18544453
PBX1 Activation 17200190
PBX2 Unknown 19356220
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000502 Component Proteasome complex IDA 9452483
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 9452483, 10364224, 10855792, 15161933, 15215856, 15743842, 16186510, 16275660, 16306228, 16407162, 16449189, 16525503, 17314412, 17525332, 17681147, 17872946, 18654987, 18656546, 18711132, 18775313, 19275885, 19570996, 19818707, 19822669, 20414249, 21135095, 21343306, 21645854, 2182
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601023 12666 ENSG00000165280
Protein
UniProt ID P55072
Protein name Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)
Protein function Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Gol
PDB 3EBB , 3HU1 , 3HU2 , 3HU3 , 3QC8 , 3QQ7 , 3QQ8 , 3QWZ , 3TIW , 4KDI , 4KDL , 4KLN , 4KO8 , 4KOD , 4P0A , 5B6C , 5C18 , 5C19 , 5C1A , 5C1B , 5DYG , 5DYI , 5EPP , 5FTJ , 5FTK , 5FTL , 5FTM , 5FTN , 5GLF , 5IFS , 5IFW , 5KIW , 5KIY , 5X4L , 6G2V , 6G2W , 6G2X , 6G2Y , 6G2Z , 6G30 , 6HD0 , 6MCK , 7BP8 , 7BP9 , 7BPA , 7BPB , 7JY5 , 7K56 , 7K57 , 7K59 , 7L5W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02359 CDC48_N 25 108 Cell division protein 48 (CDC48), N-terminal domain Domain
PF02933 CDC48_2 125 191 Cell division protein 48 (CDC48), domain 2 Domain
PF00004 AAA 241 371 ATPase family associated with various cellular activities (AAA) Domain
PF17862 AAA_lid_3 393 454 AAA+ lid domain Domain
PF00004 AAA 514 647 ATPase family associated with various cellular activities (AAA) Domain
PF17862 AAA_lid_3 669 714 AAA+ lid domain Domain
PF09336 Vps4_C 711 762 Vps4 C terminal oligomerisation domain Domain
Sequence
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDV
KYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKR
EDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGI
PDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRW
ALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPL
PDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL
QQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
Sequence length 806
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth disease type 2Y rs864309501, rs864309502 N/A
Frontotemporal Dementia With Or Without Amyotrophic Lateral Sclerosis Frontotemporal dementia and/or amyotrophic lateral sclerosis 6 rs387906789, rs121909334, rs387906790, rs863225291 N/A
Inclusion Body Myopathy With Paget Disease And Frontotemporal Dementia Inclusion body myopathy with Paget disease of bone and frontotemporal dementia type 1 rs121909331, rs121909332, rs121909334, rs121909335, rs863225291, rs121909329, rs121909330 N/A
alzheimer disease Alzheimer disease rs866101707 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Inclusion body myopathy Inclusion Body Myopathy, Dominant N/A N/A ClinVar
Mental retardation intellectual disability N/A N/A ClinVar
Neurodevelopmental Disorders complex neurodevelopmental disorder, neurodevelopmental disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 25970786
Adenocarcinoma of Lung Associate 38167084
Alzheimer Disease Associate 23715207, 28692196
Amyotrophic Lateral Sclerosis Associate 21145000, 21920633, 22210628, 22572540, 22739338, 23056506, 23152587, 23349634, 23755159, 24885147, 25125609, 25492614, 25775548, 26475856, 28282387
View all (20 more)
Amyotrophic lateral sclerosis 1 Associate 22572540, 23152587, 25492614, 25618255, 34520757
Antisocial Personality Disorder Associate 17935506
Aphasia Primary Progressive Associate 22900631
Astrocytoma Associate 35841038
Ataxia Associate 34130600
Body Weight Associate 25492614