Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7412
Gene name Gene Name - the full gene name approved by the HGNC.	Vascular cell adhesion molecule 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VCAM1
Synonyms (NCBI Gene) Gene synonyms aliases	CD106, INCAM-100
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in

Show/Hide all(310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004007	hsa-miR-200a-3p	Microarray	17875710
MIRT004081	hsa-miR-126-3p	Luciferase reporter assay, Western blot	18227515
MIRT004081	hsa-miR-126-3p	Luciferase reporter assay, Western blot	18227515
MIRT020917	hsa-miR-155-5p	qRT-PCR	21310411
MIRT004081	hsa-miR-126-3p	Reporter assay;Other	18227515
MIRT715363	hsa-miR-181a-5p	HITS-CLIP	19536157
MIRT715362	hsa-miR-181c-5p	HITS-CLIP	19536157
MIRT715361	hsa-miR-181d-5p	HITS-CLIP	19536157
MIRT715360	hsa-miR-4262	HITS-CLIP	19536157
MIRT715359	hsa-miR-181b-5p	HITS-CLIP	19536157
MIRT715358	hsa-miR-506-5p	HITS-CLIP	19536157
MIRT715357	hsa-miR-211-3p	HITS-CLIP	19536157
MIRT715356	hsa-miR-4270	HITS-CLIP	19536157
MIRT715355	hsa-miR-4441	HITS-CLIP	19536157
MIRT715354	hsa-miR-6754-5p	HITS-CLIP	19536157
MIRT715353	hsa-miR-3691-3p	HITS-CLIP	19536157
MIRT715352	hsa-miR-3127-5p	HITS-CLIP	19536157
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT707385	hsa-miR-3183	HITS-CLIP	21572407
MIRT707384	hsa-miR-4723-3p	HITS-CLIP	21572407
MIRT707383	hsa-miR-6769b-3p	HITS-CLIP	21572407
MIRT707382	hsa-miR-136-5p	HITS-CLIP	21572407
MIRT707381	hsa-miR-6845-3p	HITS-CLIP	21572407
MIRT707380	hsa-miR-7110-3p	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	23313552
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT504350	hsa-miR-23c	HITS-CLIP	23313552
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT635479	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT635478	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT635477	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT635476	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT635475	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT635474	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT635473	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT610905	hsa-miR-5092	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT533259	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT533258	hsa-miR-6856-3p	PAR-CLIP	22012620
MIRT533257	hsa-miR-5694	PAR-CLIP	22012620
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT533256	hsa-miR-96-3p	PAR-CLIP	22012620
MIRT533255	hsa-miR-2467-3p	PAR-CLIP	22012620
MIRT533254	hsa-miR-2116-5p	PAR-CLIP	22012620
MIRT533253	hsa-miR-22-5p	PAR-CLIP	22012620
MIRT533252	hsa-miR-6844	PAR-CLIP	22012620
MIRT533251	hsa-miR-1273h-3p	PAR-CLIP	22012620
MIRT533250	hsa-miR-3678-3p	PAR-CLIP	22012620
MIRT533249	hsa-miR-4677-5p	PAR-CLIP	22012620
MIRT533248	hsa-miR-6516-5p	PAR-CLIP	22012620
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT533255	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT533257	hsa-miR-5694	PAR-CLIP	27292025
MIRT533248	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT004081	hsa-miR-126-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31474826
MIRT715363	hsa-miR-181a-5p	HITS-CLIP	19536157
MIRT715362	hsa-miR-181c-5p	HITS-CLIP	19536157
MIRT715361	hsa-miR-181d-5p	HITS-CLIP	19536157
MIRT715360	hsa-miR-4262	HITS-CLIP	19536157
MIRT715359	hsa-miR-181b-5p	HITS-CLIP	19536157
MIRT715358	hsa-miR-506-5p	HITS-CLIP	19536157
MIRT715357	hsa-miR-211-3p	HITS-CLIP	19536157
MIRT715356	hsa-miR-4270	HITS-CLIP	19536157
MIRT715355	hsa-miR-4441	HITS-CLIP	19536157
MIRT715354	hsa-miR-6754-5p	HITS-CLIP	19536157
MIRT715353	hsa-miR-3691-3p	HITS-CLIP	19536157
MIRT715352	hsa-miR-3127-5p	HITS-CLIP	19536157
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT707385	hsa-miR-3183	HITS-CLIP	21572407
MIRT707384	hsa-miR-4723-3p	HITS-CLIP	21572407
MIRT707383	hsa-miR-6769b-3p	HITS-CLIP	21572407
MIRT707382	hsa-miR-136-5p	HITS-CLIP	21572407
MIRT707381	hsa-miR-6845-3p	HITS-CLIP	21572407
MIRT707380	hsa-miR-7110-3p	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	21572407
MIRT504350	hsa-miR-23c	HITS-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT504355	hsa-miR-6074	HITS-CLIP	23313552
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT504350	hsa-miR-23c	HITS-CLIP	23313552
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT635479	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT635478	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT635477	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT635476	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT635475	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT635474	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT635473	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT619599	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT619598	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT504356	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	HITS-CLIP	23824327
MIRT610905	hsa-miR-5092	HITS-CLIP	23824327
MIRT504354	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT504353	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT504352	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT504351	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT504350	hsa-miR-23c	HITS-CLIP	23824327
MIRT504357	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT504355	hsa-miR-6074	PAR-CLIP	21572407
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT504350	hsa-miR-23c	PAR-CLIP	21572407
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT533259	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT533258	hsa-miR-6856-3p	PAR-CLIP	22012620
MIRT533257	hsa-miR-5694	PAR-CLIP	22012620
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT533256	hsa-miR-96-3p	PAR-CLIP	22012620
MIRT533255	hsa-miR-2467-3p	PAR-CLIP	22012620
MIRT533254	hsa-miR-2116-5p	PAR-CLIP	22012620
MIRT533253	hsa-miR-22-5p	PAR-CLIP	22012620
MIRT533252	hsa-miR-6844	PAR-CLIP	22012620
MIRT533251	hsa-miR-1273h-3p	PAR-CLIP	22012620
MIRT533250	hsa-miR-3678-3p	PAR-CLIP	22012620
MIRT533249	hsa-miR-4677-5p	PAR-CLIP	22012620
MIRT533248	hsa-miR-6516-5p	PAR-CLIP	22012620
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT504357	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT504356	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT504355	hsa-miR-6074	PAR-CLIP	23446348
MIRT504354	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT504353	hsa-miR-130a-5p	PAR-CLIP	23446348
MIRT504352	hsa-miR-23a-3p	PAR-CLIP	23446348
MIRT504351	hsa-miR-23b-3p	PAR-CLIP	23446348
MIRT504350	hsa-miR-23c	PAR-CLIP	23446348
MIRT756150	hsa-miR-95-3p	Western blotting, qRT-PCR	36467343
MIRT756469	hsa-miR-182-5p	qRT-PCR	38796528
MIRT1483204	hsa-miR-2116	CLIP-seq
MIRT1483205	hsa-miR-4269	CLIP-seq
MIRT1483206	hsa-miR-4514	CLIP-seq
MIRT1483207	hsa-miR-452	CLIP-seq
MIRT1483208	hsa-miR-4676-3p	CLIP-seq
MIRT1483209	hsa-miR-4692	CLIP-seq
MIRT1483210	hsa-miR-4742-5p	CLIP-seq
MIRT1483211	hsa-miR-507	CLIP-seq
MIRT1483212	hsa-miR-557	CLIP-seq
MIRT1483213	hsa-miR-577	CLIP-seq
MIRT1555382	hsa-miR-1825	CLIP-seq
MIRT1555383	hsa-miR-202	CLIP-seq
MIRT1555384	hsa-miR-204	CLIP-seq
MIRT1555385	hsa-miR-211	CLIP-seq
MIRT1555386	hsa-miR-3121-5p	CLIP-seq
MIRT1555387	hsa-miR-3130-5p	CLIP-seq
MIRT1555388	hsa-miR-4287	CLIP-seq
MIRT1555389	hsa-miR-4482	CLIP-seq
MIRT1555390	hsa-miR-4678	CLIP-seq
MIRT1555391	hsa-miR-4685-3p	CLIP-seq
MIRT1555392	hsa-miR-4766-5p	CLIP-seq
MIRT1555393	hsa-miR-4795-3p	CLIP-seq
MIRT2365788	hsa-miR-1207-3p	CLIP-seq
MIRT2365789	hsa-miR-3974	CLIP-seq
MIRT2365790	hsa-miR-545	CLIP-seq
MIRT2659385	hsa-miR-1284	CLIP-seq
MIRT2659386	hsa-miR-3124-3p	CLIP-seq
MIRT1555387	hsa-miR-3130-5p	CLIP-seq
MIRT2659387	hsa-miR-3144-3p	CLIP-seq
MIRT2659388	hsa-miR-3605-3p	CLIP-seq
MIRT2659389	hsa-miR-3678-5p	CLIP-seq
MIRT2659390	hsa-miR-3919	CLIP-seq
MIRT2659391	hsa-miR-3945	CLIP-seq
MIRT2659392	hsa-miR-4253	CLIP-seq
MIRT1555389	hsa-miR-4482	CLIP-seq
MIRT2659393	hsa-miR-4528	CLIP-seq
MIRT2659394	hsa-miR-4712-5p	CLIP-seq
MIRT2659395	hsa-miR-4797-5p	CLIP-seq
MIRT2659396	hsa-miR-494	CLIP-seq
MIRT2659397	hsa-miR-770-5p	CLIP-seq
MIRT2659385	hsa-miR-1284	CLIP-seq
MIRT2659386	hsa-miR-3124-3p	CLIP-seq
MIRT1555387	hsa-miR-3130-5p	CLIP-seq
MIRT2659387	hsa-miR-3144-3p	CLIP-seq
MIRT2659388	hsa-miR-3605-3p	CLIP-seq
MIRT2659389	hsa-miR-3678-5p	CLIP-seq
MIRT2659390	hsa-miR-3919	CLIP-seq
MIRT2659391	hsa-miR-3945	CLIP-seq
MIRT2659392	hsa-miR-4253	CLIP-seq
MIRT1555389	hsa-miR-4482	CLIP-seq
MIRT2659393	hsa-miR-4528	CLIP-seq
MIRT2659394	hsa-miR-4712-5p	CLIP-seq
MIRT2659395	hsa-miR-4797-5p	CLIP-seq
MIRT2659396	hsa-miR-494	CLIP-seq
MIRT2659397	hsa-miR-770-5p	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
EP300	Activation	19281832
HDAC4	Activation	19281832
HOXA9	Unknown	22269951
IKBKB	Repression	18600306
IRF1	Unknown	15265939;22182512
JUN	Activation	16271621
NFKB1	Activation	10329958;10946302;11359843;16271621;16317091;16385502;19281832;19422386;22708120
NFKB1	Unknown	10553096;10833420;16453001
POU2F1	Repression	9694713
RELA	Activation	10329958;10946302;11359843;16317091;16385502;19281832;19422386;22708120
RELA	Unknown	10553096;10833420;16453001;23042817

Show/Hide all(60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0002102	Component	Podosome	IDA	15220135
GO:0002544	Process	Chronic inflammatory response	IEA
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IDA	1377228, 15220135, 23620790
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IMP	19738201
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005615	Component	Extracellular space	IEA
GO:0005769	Component	Early endosome	IDA	23474851
GO:0005783	Component	Endoplasmic reticulum	IDA	23474851
GO:0005794	Component	Golgi apparatus	IDA	23474851
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	12878595
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	12082081
GO:0006954	Process	Inflammatory response	IC	9572733
GO:0006954	Process	Inflammatory response	IDA	22970700
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IDA	16809613
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	1715889
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	1381355, 1715889, 2688898
GO:0007160	Process	Cell-matrix adhesion	IDA	18308860
GO:0007584	Process	Response to nutrient	IEA
GO:0008131	Function	Primary methylamine oxidase activity	IDA	23474851
GO:0009308	Process	Amine metabolic process	IDA	23474851
GO:0009897	Component	External side of plasma membrane	IDA	1377228
GO:0009986	Component	Cell surface	IDA	1715889, 23474851
GO:0009986	Component	Cell surface	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0010212	Process	Response to ionizing radiation	IEA
GO:0016020	Component	Membrane	IEA
GO:0022614	Process	Membrane to membrane docking	IEP	12082081
GO:0030175	Component	Filopodium	IDA	12082081
GO:0030183	Process	B cell differentiation	IC	1715889
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033631	Process	Cell-cell adhesion mediated by integrin	IGI	11078691
GO:0034113	Process	Heterotypic cell-cell adhesion	IGI	11078691
GO:0035094	Process	Response to nicotine	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	1381355
GO:0042383	Component	Sarcolemma	IEA
GO:0045177	Component	Apical part of cell	IDA	12082081
GO:0045471	Process	Response to ethanol	IEA
GO:0050839	Function	Cell adhesion molecule binding	IDA	1377228
GO:0050839	Function	Cell adhesion molecule binding	IPI	12082081
GO:0050901	Process	Leukocyte tethering or rolling	IDA	18308860
GO:0050901	Process	Leukocyte tethering or rolling	IEP	2688898
GO:0060326	Process	Cell chemotaxis	IEA
GO:0060384	Process	Innervation	IEA
GO:0060945	Process	Cardiac neuron differentiation	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071065	Component	Alpha9-beta1 integrin-vascular cell adhesion molecule-1 complex	IDA	15220135
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098631	Function	Cell adhesion mediator activity	IDA	22970700
GO:1904646	Process	Cellular response to amyloid-beta	IGI	11078691

MIM	HGNC	e!Ensembl
192225	12663	ENSG00000162692

Protein

UniProt ID

P19320

Protein name

Vascular cell adhesion protein 1 (V-CAM 1) (VCAM-1) (INCAM-100) (CD antigen CD106) [Cleaved into: Soluble Vascular Cell Adhesion Molecule-1]

Protein function

Cell adhesion glycoprotein predominantly expressed on the surface of endothelial cells that plays an important role in immune surveillance and inflammation (PubMed:31310649). Acts as a major regulator of leukocyte adhesion to the endothelium thr

PDB

1IJ9 , 1VCA , 1VSC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	25 → 112	Immunoglobulin I-set domain	Domain
PF05790	C2-set	133 → 221	Immunoglobulin C2-set domain	Domain
PF00047	ig	229 → 306	Immunoglobulin domain	Domain
PF07679	I-set	314 → 400	Immunoglobulin I-set domain	Domain
PF05790	C2-set	421 → 509	Immunoglobulin C2-set domain	Domain
PF13927	Ig_3	515 → 583		Domain
PF07679	I-set	605 → 685	Immunoglobulin I-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue.

Sequence

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV

Sequence length

739

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Prostate cancer	Prostate cancer (early onset)	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (313)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3 Methylglutaconic Aciduria Type I	Stimulate	15158909
Acidosis	Stimulate	22110680
Acute Chest Syndrome	Stimulate	10477680
Acute Chest Syndrome	Associate	15114598
Acute Coronary Syndrome	Associate	24524679, 40599142
Acute Pain	Associate	15114598
Alzheimer Disease	Stimulate	22801742, 33720880
Alzheimer Disease	Associate	29359159, 31377428, 37762058
Amyloidosis	Associate	11318968
Amyotrophic Lateral Sclerosis	Inhibit	32586411
Anemia Aplastic	Inhibit	20443870, 28764810
Anemia Sickle Cell	Associate	10477680, 10706764, 12034693, 15114598, 21088296, 21264913, 24075742, 34956203, 39776915, 7537985, 7691241, 9371854
Anemia Sickle Cell	Stimulate	10807794
Angina Pectoris	Associate	16157948
Angina Stable	Associate	10475771
Angina Unstable	Associate	35942210
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	9844062
Antiphospholipid Syndrome	Associate	22288586, 37014642
Antiphospholipid Syndrome	Stimulate	37914735
Aortic Aneurysm Abdominal	Associate	10917982
Aortic Valve Stenosis	Associate	15120829, 37175670
Arrhythmogenic Right Ventricular Dysplasia	Stimulate	31843279
Arterial Occlusive Diseases	Stimulate	10477680
Arteriovenous Malformations	Associate	29052569
Arthritis Juvenile	Stimulate	27123929
Arthritis Psoriatic	Associate	11310827, 31864394, 7693825
Arthritis Rheumatoid	Stimulate	10233853, 37958839
Arthritis Rheumatoid	Associate	10447928, 10817566, 10817567, 11171698, 11477102, 12105209, 1374588, 16385502, 17009243, 19597294, 20039412, 22275188, 23632129, 30033738, 31812161 View all (7 more)
Arthritis Rheumatoid	Inhibit	12296865
Asthma	Associate	10514490, 15661077, 35056403, 7545095
Astrocytoma	Associate	15265232
Atherosclerosis	Associate	10377075, 10892347, 12714597, 15784173, 15866588, 17586618, 17885011, 18084847, 18420209, 21496279, 24075742, 25003524, 25413339, 26008233, 26647279 View all (14 more)
Atherosclerosis	Stimulate	27941341
Atrial Fibrillation	Stimulate	26216282
Atrial Fibrillation	Associate	36398072
Atrial Remodeling	Associate	40599142
Atrophy	Associate	32733633, 37479698
Autoimmune Diseases	Associate	1378365, 27706780
Bacterial Infections	Associate	10477399
Basal Ganglia Diseases	Associate	28919237
Behcet Syndrome	Stimulate	10333719, 17056573
Biliary Atresia	Associate	34962102, 7519822
Blood Coagulation Disorders	Stimulate	37295816
Blood Platelet Disorders	Associate	34741638
Bone Diseases	Associate	17900349
Bone Marrow Failure Disorders	Associate	28764810
Brain Neoplasms	Associate	29290808
Brain Neoplasms	Inhibit	31282941
Breast Neoplasms	Associate	10880401, 19400944, 23613720, 27340107, 36800575, 37773178
Bronchiectasis	Associate	11106214
Burkitt Lymphoma	Associate	38620074
Calcinosis Cutis	Associate	16309209, 36828890
Carcinogenesis	Associate	12854131
Carcinogenesis	Stimulate	36359790
Carcinoma Embryonal	Associate	7537851
Carcinoma Hepatocellular	Associate	23396735, 24966965, 28473332
Carcinoma Non Small Cell Lung	Associate	28535543, 34390488
Carcinoma Ovarian Epithelial	Associate	28263384
Carcinoma Pancreatic Ductal	Associate	29670110, 33178497
Carcinoma Renal Cell	Associate	21068256, 25184692, 28235946, 37622107
Carcinoma Renal Cell	Stimulate	26943029
Carcinoma Squamous Cell	Associate	16309209, 33588862, 35779918
Cardiomyopathy Dilated	Associate	34593936
Cardiovascular Diseases	Associate	24205197, 24699314, 25575156, 28646244, 30653588, 33050491, 33737636, 34346841, 36012132
Carotid Artery Diseases	Stimulate	24401216
Carotid Stenosis	Associate	29452833
Cerebral Hemorrhage	Associate	29052569, 35833818
Cerebral Small Vessel Diseases	Associate	14615367
Cerebrovascular Disorders	Associate	19632255
Cerebrovascular Disorders	Stimulate	28476896
Chagas Disease	Associate	11309161
Chlamydial Pneumonia	Stimulate	32601108
Cholangiocarcinoma	Associate	36828890
Chondrosarcoma	Associate	12587980
Chronic Disease	Inhibit	33246119
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	24854267
Chronic Periodontitis	Associate	27391418
Churg Strauss Syndrome	Associate	1605306
Cognition Disorders	Associate	33720880, 36459652
Colitis Ulcerative	Stimulate	7541009
Colorectal Neoplasms	Associate	18084316, 18084318, 29188362
Conjunctivitis Allergic	Associate	9497473
Coronary Artery Disease	Associate	18420209, 24699314, 34320932, 36928188, 37060905, 9626834
Coronary Artery Disease	Stimulate	25890092
Coronary Disease	Associate	32007502, 34850451, 34861059, 39344313
COVID 19	Associate	32582936, 33317616, 34253708, 34450402, 34741638, 36116160
COVID 19	Inhibit	35033854
COVID 19	Stimulate	35351411
Craniosynostoses	Associate	22028906
Crohn Disease	Associate	7541009
Cystic Fibrosis	Associate	28646244
Cysts	Associate	31443713
Dengue	Associate	26421267, 31778418
Dermatitis	Associate	10086854, 27206134
Dermatitis	Stimulate	30510068
Dermatomyositis	Associate	22740338, 8800304, 9099932
Diabetes Gestational	Stimulate	31061324
Diabetes Mellitus	Associate	20111020, 25287126, 40065310
Diabetes Mellitus	Stimulate	34506229
Diabetes Mellitus Type 1	Associate	27406064
Diabetes Mellitus Type 2	Associate	10868972
Diabetes Mellitus Type 2	Inhibit	20111020
Diabetes Mellitus Type 2	Stimulate	29025405
Diabetic Nephropathies	Associate	29854824, 34506229, 35991124, 36949528, 38174742, 39510044
Diarrhea 5 With Tufting Enteropathy Congenital	Stimulate	38172172
Disease	Associate	12105209, 12393616
Down Syndrome	Associate	27293319
Drug Hypersensitivity	Associate	21502805, 7529260, 9176402
Drug Hypersensitivity	Stimulate	7542574
Endometriosis	Associate	31443713, 35616875, 36660246
Eosinophilia	Associate	21502805, 37548395
Epiretinal Membrane	Associate	7517695
Esophageal Neoplasms	Associate	33323552
Essential Hypertension	Associate	25897102
Eyelid Diseases	Stimulate	20220050
Familial Primary Pulmonary Hypertension	Associate	32714978
Fetal Growth Retardation	Inhibit	27706617
Fibrosis	Associate	34506229, 37266443
Gastritis	Stimulate	34471638
Giant Cell Arteritis	Associate	10643715
Glioblastoma	Associate	24045955, 28365151
Glioma	Associate	23593320, 24787244
Glomerulonephritis	Associate	8675737
Glomerulonephritis Membranous	Associate	9551397
Glucosephosphate Dehydrogenase Deficiency	Associate	18031538, 8546198
Glucosephosphate Dehydrogenase Deficiency	Stimulate	33050491
Glycosuria Renal	Associate	8675737
Graft vs Host Disease	Associate	1370927
Graft vs Host Disease	Stimulate	31300420
Graves Disease	Associate	1378365
Graves Ophthalmopathy	Stimulate	33498689
Graves Ophthalmopathy	Associate	9158103
Heart Failure	Associate	34593936, 37909603
Heart Injuries	Associate	26173590
Hepatic Veno Occlusive Disease	Associate	26172478
Hepatitis Alcoholic	Associate	33954832
HIV Infections	Associate	10403921, 8952525
Hodgkin Disease	Associate	1605306, 22457206, 9722296
Hypercalciuria Absorptive 2	Associate	27161247
Hyperglycemia	Stimulate	20592773
Hyperinsulinism	Stimulate	18582564
Hyperkeratosis lenticularis perstans	Stimulate	27787379
Hypertension Portal	Associate	34962102
Hypertension Pregnancy Induced	Stimulate	27706617
Hypertension Pulmonary	Associate	18383329, 37955024
Hypertriglyceridemia	Associate	21030716
Hypoxia	Stimulate	10477680, 28235946, 37071849
Hypoxia Brain	Inhibit	37246768
IgA Vasculitis	Associate	10460192, 13130466, 8675737
Immune System Diseases	Associate	35056403
Infections	Stimulate	10514490, 24418552
Infections	Associate	11292691
Inflammation	Associate	10233853, 10447928, 10514490, 10643715, 12105209, 1379595, 1382576, 14565715, 15191888, 15502879, 15805138, 16157948, 1708800, 18031538, 18241674 View all (66 more)
Inflammation	Stimulate	12427124, 1707873, 19041175, 24600034, 25641748, 30462552, 31316519, 7533787
Inflammatory Bowel Diseases	Associate	11106568, 27552332
Inflammatory Bowel Diseases	Stimulate	34561227
Intracranial Arteriovenous Malformations	Stimulate	29052569
Iridocyclitis	Associate	35178133
Kidney Diseases	Associate	16156864, 38174742
Kidney Failure Chronic	Associate	33574979
Leprosy	Associate	27706378
Leukemia	Associate	11264180, 18024794, 22207686, 33127669, 7694686
Leukemia B Cell	Associate	11160154
Leukemia Biphenotypic Acute	Associate	33127669
Leukemia Lymphocytic Chronic B Cell	Associate	16840734, 19383907, 19828693, 9886331
Leukemia Lymphoma Adult T Cell	Associate	7689874
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	27050372
Leukemia T Cell	Associate	35210567
Leukemic Infiltration	Stimulate	37563649
Leukocyte adhesion deficiency type 1	Associate	14551137
Lichen Planus Oral	Associate	19680199
Liver Diseases	Associate	16156864, 28473332, 35246921
Liver Diseases Alcoholic	Stimulate	33954832
Liver Failure	Associate	35726350
Lung Diseases Interstitial	Associate	10329599
Lung Diseases Interstitial	Stimulate	32691471
Lung Neoplasms	Associate	22266541, 34427969
Lupus Erythematosus Systemic	Stimulate	24083390, 30510068
Lupus Erythematosus Systemic	Associate	24699314, 27211902, 7521807, 7694552
Lupus Erythematosus Systemic	Inhibit	35332100
Lyme Disease	Associate	11179355
Lymphatic Metastasis	Stimulate	12854131, 25450269
Lymphatic Metastasis	Associate	31713298
Lymphedema	Associate	23613720
Lymphohistiocytosis Hemophagocytic	Associate	37653176
Lymphoma	Associate	1373268
Lymphoma B Cell	Associate	15078922
Lymphoma Follicular	Stimulate	12028024
Lymphoma Follicular	Associate	35965624
Lymphoma Mantle Cell	Associate	36359790
Lymphoma T Cell	Associate	36417130
Macular Degeneration	Stimulate	35370941
Macular Edema	Associate	34211611
Malaria Cerebral	Associate	16705810
Malnutrition	Stimulate	31398886
Melanoma	Associate	1281617, 1370233, 20181932, 21061269, 21129359, 35188342, 37240247, 7525548
Meningioma	Associate	20406964
Metabolic Syndrome	Associate	18761738
Mitochondrial Diseases	Associate	40176604
Mixed Connective Tissue Disease	Associate	15608947
Mucocutaneous Lymph Node Syndrome	Associate	17456996, 28069066
Multiple Myeloma	Associate	10606891, 11154207, 25341809, 30736330, 32526706, 38280104
Multiple Sclerosis	Stimulate	24686948
Multiple Sclerosis	Associate	25774903, 28919237
Multiple Sclerosis Chronic Progressive	Stimulate	24686948
Multiple Sclerosis Chronic Progressive	Associate	25774903
Muscular Diseases	Associate	15608947, 9099932
Muscular Dystrophy Duchenne	Associate	32157826
Mycosis Fungoides	Associate	1281618
Myocardial Infarction	Stimulate	25413339
Myocardial Ischemia	Associate	21808112
Myositis	Associate	19353432, 9099932
Myositis Inclusion Body	Associate	32259312
Myotonic Dystrophy	Stimulate	28940978
Nasal Polyps	Associate	18629784, 8876553, 9176402
Nasopharyngeal Carcinoma	Associate	30659926
Necrobiotic Xanthogranuloma	Associate	24428816
Neointima	Associate	8995639
Neoplasm Metastasis	Associate	12854131, 25450269, 26537072, 27340107, 29290808, 36800575, 36838824, 37773178
Neoplasms	Associate	12358905, 12412796, 12854131, 15265232, 16309209, 1713678, 1716464, 18248671, 19041175, 24045955, 26497209, 26537072, 27340107, 27462861, 27509931 View all (14 more)
Neoplasms	Inhibit	19400944, 34445568
Neoplasms	Stimulate	36828890, 37622107
Neoplasms Adipose Tissue	Associate	21047923
Nephritis Interstitial	Associate	34506229
Neurodegenerative Diseases	Associate	32733633
Neurologic Manifestations	Stimulate	34450402
Nose Diseases	Stimulate	18629784
Obesity	Stimulate	19249917, 21481180
Obesity	Associate	30572569
Optic Nerve Glioma	Associate	15265232
Osteoarthritis	Associate	17900349, 31146598, 31812161, 35743247, 9099936
Osteoarthritis	Stimulate	32384383
Osteosarcoma	Associate	23720361, 32847038
Overweight	Associate	29244802
Pancreatic Neoplasms	Associate	29670110
Pancreatitis Acute Necrotizing	Associate	8675737
Paraparesis Tropical Spastic	Stimulate	36052089
Parathyroid Neoplasms	Associate	24681779
Parkinson Disease	Associate	31068198, 32733633, 40176604
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	18396786
Periodontal Diseases	Associate	27391418
Periodontitis	Associate	27391418
Peripheral Vascular Diseases	Associate	25287126
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	7517695
Pleural Effusion	Associate	24069325
Polycystic Ovary Syndrome	Associate	23898913
Polycystic Ovary Syndrome	Inhibit	35551681
Polycythemia Vera	Associate	40507944
Polyps	Associate	8876553
Pre Eclampsia	Associate	28558299, 37446111
Pre Eclampsia	Inhibit	32432770
Pre Eclampsia	Stimulate	39735539
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	35210567
Preeclamptic toxemia	Inhibit	29172779
Preeclamptic toxemia	Stimulate	40187599
Primary hyperoxaluria type 1	Associate	27161247
Progeria	Associate	32032552
Prostatic Neoplasms	Stimulate	19041175
Prostatic Neoplasms	Associate	25277191, 25683512, 26537072, 33569050
Protein Energy Malnutrition	Associate	38017491
Pulmonary Arterial Hypertension	Stimulate	18029384, 24083390
Pulmonary Arterial Hypertension	Associate	20808962, 33816621
Pulmonary edema of mountaineers	Associate	30254217
Pulmonary Embolism	Stimulate	33810533
Pulpitis	Associate	35334501
Renal Insufficiency Chronic	Associate	23409162, 38017491, 38174742
Reperfusion Injury	Associate	12829075
Respiratory Distress Syndrome	Associate	32321279
Retinal Vein Occlusion	Associate	35370941
Rhinitis Allergic	Associate	33966399
Sarcoidosis	Stimulate	9797497
Sarcopenia	Associate	37909603
Scleroderma Systemic	Stimulate	18029384, 24083390
Scleroderma Systemic	Inhibit	37246768
Sepsis	Associate	10477399
Severe Dengue	Associate	31778418
Sick Sinus Syndrome	Associate	10403921
Skin Ulcer	Associate	10086854
Sleep Apnea Obstructive	Stimulate	27693879
Squamous Cell Carcinoma of Head and Neck	Associate	16309209, 32441311
Squamous Cell Carcinoma of Head and Neck	Stimulate	25450269
ST Elevation Myocardial Infarction	Associate	32198366
Stiff Skin Syndrome	Associate	28441665
Stomach Neoplasms	Associate	12854131, 22408359, 31886120, 32373959, 35936362, 37563649, 9529982
Stroke	Associate	12393616, 21808112, 24075742
Synovitis	Associate	11014344
Systemic carnitine deficiency	Stimulate	34320932
Systemic Vasculitis	Associate	8675737
Takayasu Arteritis	Stimulate	16802373
Taste Disorders	Associate	7538286
Thromboangiitis Obliterans	Associate	34259105
Thrombocytopenia 1	Associate	20130240
Thromboembolism	Stimulate	21808112
Thrombosis	Associate	25988387
Triple Negative Breast Neoplasms	Associate	31731625
Tuberculosis Spinal	Associate	28829887
Tuberous Sclerosis	Associate	19912235
Ulcer	Associate	11106568
Urinary Bladder Neoplasms	Associate	24666523
Uveitis	Associate	9640196
Varicose Ulcer	Stimulate	27994710
Vascular Diseases	Associate	18190605, 25323856, 26008233, 26761204, 30871567, 35332100, 38195507, 40187599, 9152314
Vascular Diseases	Stimulate	33954832
Vascular System Injuries	Associate	15805138, 20808962, 25413339, 33608030
Vasculitis	Associate	10027408, 18490752, 8565309
Vasculitis Lymphocytic Nodular	Associate	7525658
Venous Insufficiency	Associate	10086854
Ventricular Remodeling	Associate	40599142
Virus Diseases	Associate	36398072
Virus Diseases	Stimulate	7537985
von Hippel Lindau Disease	Stimulate	28235946
Waldenstrom Macroglobulinemia	Associate	27301862
Xanthomatosis	Associate	24428816

VCAM1 (vascular cell adhesion molecule 1)